KEGG   Sporosarcina psychrophila: AZE41_01465Help
Entry
AZE41_01465       CDS       T04327                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AZE41_01465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spsy03011]
    AZE41_01465
Ribosome [BR:spsy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AZE41_01465
  Bacteria
    AZE41_01465
  Archaea
    AZE41_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMQ04741
UniProt: A0A127VTZ6
Position
333553..333897
Genome map
AA seq 114 aa AA seqDB search
MQQAKATARTVRIASRKVRLVVDLIRGKKVGEAIAILRLTPKAASPVVEKVLKSAIANAE
HNYEMDVENLFISEVFVDEGPTMKRFRPRAQGRASAINKRTSHITLVVSEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcaaaagctactgcccgcacagtccgtattgcctctcgtaaagtccgtttg
gtcgttgatcttatccgaggcaaaaaagtcggtgaagctatcgcgattctacgcctgacg
ccaaaagcggcttctccggttgtagaaaaagttttgaaatcagcgattgcaaatgctgaa
cataactatgaaatggatgtcgaaaacctatttatcagcgaagtattcgttgatgaaggt
ccgactatgaaacgtttccgaccacgcgcacaaggacgtgcgagcgcaattaataaacgt
acgagccacatcacattagtggtatctgaaaagaaggagggataa

DBGET integrated database retrieval system