KEGG   Sporosarcina psychrophila: AZE41_09605Help
Entry
AZE41_09605       CDS       T04327                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AZE41_09605
Enzymes [BR:spsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AZE41_09605
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AZE41_09605
    1.1.1.-  
     AZE41_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMQ06158
UniProt: A0A127VY90
Position
2006431..2007480
Genome map
AA seq 349 aa AA seqDB search
MRAAVWYKANDIRVEEREVKEVLANDVKVRVAWTGICGSDLHEYHEGPVLIPGNGPDPLT
NQEAPLTLGHEFSGIVEEVGSDVTRFKAGDRVVINPLITYGNKSSEYDIYDGFTFVGLGS
DGGFADFAVVSEKNVYALPKGLSLEEGALVEPMAVTVQAVKEGGLQAGQTVAVFGAGPIG
LLTIIAAKAQGANKIVVFDLSEERLEKALAVGATHVFNSGKVNPLEVGKEIEPEGFDVSF
EVAGVEITLNQAIKITKTRGTVVIVSIFPKPVSFSPMDLTASGIKITSTLAYEPAVFQKT
IDMMDSGEINPKEIITSRIELEELVEKGFDALTNDKTQAKILVKLSGEQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagtatggtataaagccaatgatattcgtgttgaagagcgtgaagtgaaa
gaagttcttgcaaatgatgtaaaagtacgagtggcatggactggtatttgcggcagtgac
ttgcatgaataccatgaaggcccagtattaattccaggaaatggtccggatccattgaca
aaccaggaagcgccactaacgttagggcatgagttttcaggtattgttgaggaagttggt
tctgatgtgacacgctttaaagcaggagatcgtgtcgttatcaatccgttgattacatat
ggcaataaatcgtctgagtatgatatatatgatggcttcacgtttgttggactaggttct
gacggtggatttgcagactttgcagtcgtatctgagaaaaacgtttatgcacttccgaaa
ggtttatctcttgaagaaggcgcacttgtagaaccgatggcagttactgtacaggccgtg
aaagaaggcggattgcaagctggtcaaacggttgctgtatttggtgctggcccgattgga
ttattgacaatcattgctgcaaaagcacagggtgcaaacaaaattgttgtatttgacttg
tctgaagagcgcttggaaaaggcgttggcagtaggagctacacatgtgttcaactcaggt
aaagtgaatcctttggaagttggaaaagagattgaacctgaaggctttgatgtctcgttc
gaggtagctggcgtagaaattacgttgaaccaggcaattaaaatcacaaaaacgaggggg
acggttgttattgtatctatattcccgaaaccagtttccttctcaccaatggatttaacg
gcttccggtattaaaattacatcaacactagcttatgagcctgcagtattccagaaaaca
attgatatgatggattctggcgaaattaaccctaaagaaattattacgagccgtattgag
cttgaagagcttgttgaaaaaggttttgatgcgttaacgaatgacaaaacgcaagcgaag
attcttgttaaattgagcggcgaacaataa

DBGET integrated database retrieval system