KEGG   Sporosarcina psychrophila: AZE41_11440Help
Entry
AZE41_11440       CDS       T04327                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00071  Fatty acid degradation
spsy00072  Synthesis and degradation of ketone bodies
spsy00280  Valine, leucine and isoleucine degradation
spsy00310  Lysine degradation
spsy00362  Benzoate degradation
spsy00380  Tryptophan metabolism
spsy00620  Pyruvate metabolism
spsy00630  Glyoxylate and dicarboxylate metabolism
spsy00640  Propanoate metabolism
spsy00650  Butanoate metabolism
spsy00900  Terpenoid backbone biosynthesis
spsy01100  Metabolic pathways
spsy01110  Biosynthesis of secondary metabolites
spsy01120  Microbial metabolism in diverse environments
spsy01130  Biosynthesis of antibiotics
spsy01200  Carbon metabolism
spsy01212  Fatty acid metabolism
spsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZE41_11440
   00630 Glyoxylate and dicarboxylate metabolism
    AZE41_11440
   00640 Propanoate metabolism
    AZE41_11440
   00650 Butanoate metabolism
    AZE41_11440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZE41_11440
   00072 Synthesis and degradation of ketone bodies
    AZE41_11440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZE41_11440
   00310 Lysine degradation
    AZE41_11440
   00380 Tryptophan metabolism
    AZE41_11440
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZE41_11440
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZE41_11440
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZE41_11440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spsy04147]
    AZE41_11440
Enzymes [BR:spsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZE41_11440
Exosome [BR:spsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZE41_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMQ06492
UniProt: A0A127VYZ2
Position
complement(2413019..2414203)
Genome map
AA seq 394 aa AA seqDB search
MNTYIIDGARTAFGTFGGSLKDISEVDLGVIATTQAIKRSSIPVTDIDEIIFGNIIQTNK
NSAYLARHIGLKSGLKEISSALTLNRLCGSGLQSIVSGAQSIALGDANVIVAGGTENMSL
SPHVLRSTRFGSPNKAPIVEDMLWETLTDNHVGCGMGMTAENLATKYSISREEQDQFSVD
SQNKAIAARNSGRFAEEIVPVRLKGRKGEEIIFDRDEHIREGTSVEGLAKLMPAFKKEGT
VTPGNASGINDGAAAVLLASEEYIYEHNIKPLAKIVSWGVAGVDPNIMGIGPVPASKKAL
EKAGLTLEDIDLFELNEAFAAQSLAVIKELGLDASKVNVNGGAIALGHPVGSSGTRITYS
LALELKKRGAKYGLASLCIGGGQGIAIIIENTEA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttatattattgatggtgcaagaactgcatttggtacctttggaggatcttta
aaggatattagcgaagtcgatttaggagtgatcgcaacaacacaggcgattaagcgaagt
agtattccagttacggatattgatgaaattatatttggtaacatcattcaaacgaataaa
aattcagcgtatttggctcgacatattggcttaaaaagtggtttaaaagagatatcttcg
gcattaacattaaatcgactttgcggatcaggtttacagtcgattgtatctggggcacag
tccattgctttaggggatgcaaatgtaatcgtagcgggtgggacagaaaatatgagctta
tccccacatgtattaagaagtacacgttttggatcaccaaacaaggcgccaattgttgag
gacatgttatgggagacgttaacagataatcatgttggatgtggaatgggaatgacggct
gagaacctagcaacaaaatattcgatttcgcgtgaagaacaggatcaattttccgtagat
tcacaaaacaaggcaattgctgcaagaaatagtggtcgttttgcagaagaaatcgtcccg
gttagattaaaaggtagaaaaggtgaggaaatcatctttgatagggatgagcatattcgt
gaaggcacatctgtagaaggtttagccaagttgatgcctgcttttaagaaggagggaact
gtcacgccaggtaatgctagtggaattaacgatggggcggctgctgtattattggcatct
gaggaatatatatacgaacataatataaaaccgcttgcgaaaattgtctcgtggggcgtt
gcaggggtagatcctaatattatgggaattggtcctgtaccagctagcaaaaaagcttta
gaaaaagcaggtttaacacttgaagatattgatttatttgagctaaatgaagcttttgca
gctcagtctttagcggtaattaaagaattaggacttgatgcgagtaaagttaatgttaat
ggaggtgctattgctctaggccatccggtcggctcaagcgggacccgtattacatattca
ttagctttagagttaaagaaaagaggagctaagtatggtctagcttcactttgtatcggt
ggtggacaaggtattgccattattattgaaaatactgaggcttaa

DBGET integrated database retrieval system