KEGG   Sporosarcina psychrophila: AZE41_19285Help
Entry
AZE41_19285       CDS       T04327                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00430  Taurine and hypotaurine metabolism
spsy00460  Cyanoamino acid metabolism
spsy00480  Glutathione metabolism
spsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AZE41_19285
   00460 Cyanoamino acid metabolism
    AZE41_19285
   00480 Glutathione metabolism
    AZE41_19285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spsy01002]
    AZE41_19285
Enzymes [BR:spsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AZE41_19285
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     AZE41_19285
Peptidases and inhibitors [BR:spsy01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AZE41_19285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AMQ07908
UniProt: A0A127W385
Position
complement(4122197..4123801)
Genome map
AA seq 534 aa AA seqDB search
MDYLYNPNPSIRHTAFAKNGMVATSQPLAAQAGIEIMRRGGNAIDAAIATAAALTVVEPT
SNGIGGDAFALVWVNNKLHGLNASGPAPQSLTIDAVKAQGHDKMPVYGLTPITVPGVPAA
WAELARKFGNLPLKESLEPAIRYAEEGYPLTPILGKYWNAAYKKYSTSFTTEEFDAWFTT
FAPDGRAPEIGELWKSRDHAATLHSIGESNAESFYTGELADKIDTFMQQHGGFLTKSDLA
NYQPEWVEPVSTNYRGYDVHEIPPNGQGMIALMALNILSEMNSPVPHDTQSLHEQIESMK
LAFTDGQAFITEPTDMPIKPEHLLSKAYAQQRAAKITATATCPEPYELPKGGTVYLATAD
GEGNMVSFIQSNYMGFGSGIVIPGTGIALQNRGADFSLDPNHPNALKPGKRTFHTIIPGF
LTKNGQAIGPFGVMGGYMQPQGHFQVAINTIDYKLNPQAALDAPRWQWIKDNLVHVEPGF
PNHLAQALTRLGHQIQPTLDSGSFGRGQIIWRNPKTGVLSGGTESRTDGAIAVW
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggactacctttacaacccaaatccatccatacgccataccgccttcgcaaaaaacggc
atggtcgcaacctcacagccactcgccgcacaagctggcattgaaattatgcgcagggga
ggcaacgcaattgatgcggcaatcgcgactgcggctgcacttaccgtcgtcgaaccaaca
tcaaacggtatcggcggcgatgcattcgcactcgtttgggtcaacaacaaattgcacggc
ctcaacgcttccggcccggcaccgcaatcactcacaatcgacgccgtaaaagcgcaaggc
cacgacaaaatgccagtctacggtctgacgccaatcaccgtcccaggcgtacccgcagca
tgggcggaactcgcgcgcaaatttggcaatctaccattaaaagaatcactcgaaccagcc
atccgctatgccgaagaaggctatccgctcacaccgattctcggcaaatactggaacgct
gcctacaaaaaatacagcacttcatttacaacagaagaattcgatgcatggttcaccaca
ttcgcgcccgacggtagagcaccagaaatcggtgaactttggaaatcacgagatcacgcc
gccacactacactccattggggagtcgaatgcagaatccttctacacgggagaactagcc
gacaaaatcgacactttcatgcaacaacacggcggctttctcacaaaatctgatctggca
aactaccagccagaatgggtagaacccgtctctacaaactaccgcggctacgacgttcat
gaaattccgccaaatggccaaggcatgatcgcactcatggcactcaacatcctatcggaa
atgaacagcccagtgccgcacgacacgcaatcgcttcacgaacaaattgagtctatgaag
ctcgcattcacagatggacaagcattcatcaccgaaccaactgatatgccaattaaaccc
gaacaccttctatcaaaagcgtacgcacaacaacgcgccgccaaaattacagcaaccgca
acatgtccagaaccgtatgaattaccaaaaggcggcacagtttacctggcaactgcagat
ggggaaggcaacatggtatccttcatccagtcgaattacatgggcttcggctccggtatc
gttattcctggcacaggaatcgcactccaaaaccgtggcgcagacttctcgctagatccg
aatcacccaaatgcactaaaaccgggcaaacgaacatttcacaccatcatcccaggcttc
ctaaccaaaaacggacaagccatcgggccatttggtgtcatgggcggatacatgcaaccg
caaggccatttccaagtagccatcaacacaatcgattacaaattaaatccacaagcagcc
ctcgacgcaccgcgctggcagtggataaaagacaatctagtccacgtcgaaccgggcttc
ccgaaccatctcgcccaagcactgacaagacttggtcaccaaatccagccaaccctcgac
tcaggctcatttggtcgtggccaaatcatctggcgaaatcctaaaaccggagttctatca
ggcggcaccgaatcccgaaccgacggagcaatcgccgtctggtaa

DBGET integrated database retrieval system