KEGG   Sporosarcina psychrophila: AZE41_21795Help
Entry
AZE41_21795       CDS       T04327                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00450  Selenocompound metabolism
spsy00970  Aminoacyl-tRNA biosynthesis
spsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AZE41_21795
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZE41_21795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spsy01007]
    AZE41_21795
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spsy03016]
    AZE41_21795
Enzymes [BR:spsy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AZE41_21795
Amino acid related enzymes [BR:spsy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AZE41_21795
Transfer RNA biogenesis [BR:spsy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AZE41_21795
 Prokaryotic type
   Other AARSs
    AZE41_21795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 PAF-AH_p_II Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AMQ08341
UniProt: A0A127W4A6
Position
complement(4637654..4639627)
Genome map
AA seq 657 aa AA seqDB search
MADQKKTFYITTPIYYPSGNFHIGTAYTTVASDAMARYKRLRGYDVRFLTGMDEHGQKIQ
EKAQEAGLPPQEFVDGIAETAKKVWNTMDISYDDFIRTTEERHKVIVEKIFKTFLDNGDI
YKGEYEGWYCLPCETYFTEGQLENGNCPDCGRPVKKVKEESYFFNMKKYAGRLLKFYEDN
PKFIEPESRKNEMINNFIKPGLEDLSVSRMSFDWGIKVPGDLKHVIYVWVDALTNYITAL
GYQSDDDSLFKKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGK
MSKSKGNVVYPEMLVERYGLDATRYFLLRELPFGQDGVFSPESFVERTNYDLANDLGNLL
NRSISMINKYFDGEIPTQGLVATDFDDSLTNFMTTTVGKYEASMENMQFSAVLGDLWALI
SRTNKYIDETSPWVLAKDEADKGKLASVMMHLATSLRHIAVLLQPFMTEAPKQIMTQLGL
DEKLLAWDTLGNFNAIPTGTKVVEKGVPIFPRLDADVEVVYIRDQMAITAPAENAPAEQP
AKVEVEEPVVTEISIDDFLNVDLRVATVTACERIPKADKLLKLQLDMGYEQRQVVSGIAE
HYEPEALVGQKVIVVANLKPVKLRGELSQGMILAGKSDGILKLATVDQSLENGAQVK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatcagaaaaagactttctatattactacacctatttattatccaagcgggaat
ttccatattggtaccgcatataccactgtcgcttcagacgcgatggctcgttacaaacga
ctgcgcgggtatgatgttcggttcctgactggaatggatgagcacggtcaaaagatacag
gaaaaagcgcaagaggccggactgccaccgcaggagtttgtcgatggtatcgcagagaca
gcgaaaaaggtctggaatacaatggacatttcatatgacgacttcatccgtacgacggaa
gagcgccataaagtgattgtcgaaaagatttttaaaacattccttgataacggcgatatt
tataaaggggagtacgaaggatggtattgcctaccttgtgaaacatactttacggaaggg
cagcttgaaaatggcaactgtcctgattgtggacgacctgtcaaaaaagtgaaggaagaa
tcatacttcttcaatatgaagaagtatgctggaagactgttgaagttttacgaagataat
ccgaagtttatcgaaccggaatcgcgtaaaaacgaaatgattaataactttatcaaaccg
gggcttgaagacttatctgtttctcgtatgtcgtttgattggggcataaaagttcctggg
gatctgaagcatgtcatttatgtatgggtcgatgcgttgacgaactacatcacagcgctt
ggctatcagtcagatgacgattcgttattcaaaaagtattggccggcggatgtccatgtt
gttggaaaagatattgttcgtttccatacaatttattggccgattttcttaatggcactc
gatttaccgttgccgaagaaagtttttgcgcatggtttcatcatgatgaaagatggaaaa
atgtcgaaatctaaaggcaatgtcgtctatccggaaatgcttgttgagcgctacggactc
gatgcgacacgttatttccttcttcgtgaattgccgtttgggcaagatggtgtattctca
cccgaatcctttgtggagcggacgaattatgaccttgcaaatgacctcggaaatttattg
aaccgatcaatttcgatgatcaataaatatttcgacggagagattccgacacaaggcctt
gtcgcaacagatttcgatgacagcttgacgaatttcatgacgactacagtcgggaaatac
gaagcatcaatggagaacatgcagtttagcgctgtccttggcgatttgtgggctcttata
tcgcggaccaacaaatacatcgacgagacgtctccatgggtgttagcgaaggatgaggcg
gataaagggaaactagcgtctgttatgatgcatcttgcgacatcactccgtcacattgct
gtattattgcaaccgtttatgacggaagcgcctaaacagattatgacgcaactgggtctg
gatgaaaaactgcttgcttgggatacgctggggaatttcaacgcgattccgacaggcaca
aaagtcgtagaaaagggtgtaccaatcttcccgcgcctggatgcggatgttgaagtcgtt
tatatccgtgatcagatggcgattactgcaccggctgagaatgcgcctgccgagcaacct
gcaaaagtggaagttgaagagccggtagtgacggagatttcaatcgatgatttcctgaat
gtcgatttacgcgttgcgacagtaactgcatgtgaaagaattccgaaagcagataaattg
ctgaagctccaactagatatgggttatgagcaacgacaagttgtatcgggcatcgcagaa
cattacgaacctgaggcactagtcgggcagaaagtaattgttgttgccaacttgaaacct
gtaaaattacgtggagagctatcccaaggtatgattttggctgggaaatcagatggtatt
ttgaaacttgccacagtcgatcagtcacttgaaaatggtgcacaagttaaataa

DBGET integrated database retrieval system