KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA0494Help
Entry
SPA0494           CDS       T00219                                 

Gene name
pdxB
Definition
(GenBank) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00750  Vitamin B6 metabolism
spt01100  Metabolic pathways
Module
spt_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPA0494 (pdxB)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     SPA0494 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh
Motif
Other DBs
NCBI-ProteinID: AAV76496
UniProt: Q5PCV8
Structure
PDB: 

Position
564418..565554
Genome map
AA seq 378 aa AA seqDB search
MKILVDENMPYARELFSRLGEVKAVPGRPIPVEELNHADALMVRSVTKVNESLLSGTPIN
FVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSALLMLAERDGFSLRDRTIG
IVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTLDELVQEADVLTFHTPLYKD
GPYKTLHLADETLIRRLKPGVILINACRGPVVDNAALLARLNAGQPLSVVLDVWEGEPDL
NVALLEAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGREQRVALETLLPAPEFDRITL
HGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVMCDDET
AAALLCKLGFNAVHHPAH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctcgttgatgaaaatatgccttacgcccgcgaattatttagccgcctgggt
gaggtaaaggcagtgccgggtcgcccgatccccgttgaagaattgaaccatgccgatgcg
ttaatggtgcgttcggtcacgaaagtgaatgaatcgctgctgagcggcacgccgattaac
ttcgttggtactgctacggcaggcaccgatcatgtggatgaggcatggctgaagcaggcg
ggcatcggtttttcagccgcgcccggctgtaatgctatcgccgtggtggagtatgtgttt
tccgcgctgttgatgctggccgaacgtgacggcttttcgttacgcgatcgcactataggg
attgtcggcgtgggtaacgtcggaagccggctacagaccaggcttgaagcgttgggtatc
cgcacgttgctgtgcgatccgccacgcgccgcacgcggggacgagggtgattttcgtacg
ctggatgagctggtgcaggaagcggatgtcctgactttccatacgccgctctataaagac
ggaccgtacaaaacgctgcatctggccgatgagacgctgatccgtcgactgaaacccggc
gtcattctcattaacgcctgccgcggcccggtggtggataacgccgcattgctggcgcga
ctcaatgccgggcagccgctgagcgtggtgcttgatgtgtgggagggcgaaccggatctt
aacgtcgcgctactggaagccgtggatatcggcacgtcgcatattgccggctatacgctg
gaaggcaaagcgcgcggcaccacccaggtctttgaggcgtatagcgcgtttatcggtcgc
gagcagcgtgtcgcgctggagacattactgcctgcgcctgagtttgatcgtattacgctt
cacggcccgctggatcaaccgacgctgaaaagactggcgcatttggtgtatgatgtgcgc
cgcgacgatgcgccgctgcgtaaagtcgctggaattccgggtgaatttgataaattgcgt
aaaaattatcttgagcgccgtgaatggtcgtctttatacgtgatgtgtgacgacgaaacg
gcagccgccttgctgtgtaagctaggttttaacgctgttcatcacccggcacattaa

DBGET integrated database retrieval system