KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1096Help
Entry
SPA1096           CDS       T00219                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00860  Porphyrin and chlorophyll metabolism
spt01100  Metabolic pathways
spt01110  Biosynthesis of secondary metabolites
spt01120  Microbial metabolism in diverse environments
Module
spt_M00121  Heme biosynthesis, glutamate => heme
spt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPA1096 (hemA)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     SPA1096 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_DH GlutR_N GlutR_dimer F420_oxidored OCD_Mu_crystall Sacchrp_dh_NADP GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AAV77065
UniProt: Q5PCR0
Position
1166415..1167671
Genome map
AA seq 418 aa AA seqDB search
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVE
EQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQ
VKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESL
STVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARL
QDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSV
DDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELT
TKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactcttttagcgctcggtattaaccataaaacggcacctgtatcgctgcgagaacgc
gtaacgttttcgccggacacgcttgatcaggcgctggacagcctgcttgcgcagccaatg
gtgcagggcggggtcgtgctgtcaacctgtaaccgtacagagctgtatctgagcgtggaa
gagcaggataacctgcaagaagcgctgatccgctggttatgcgattaccataacctgaac
gaggacgatctgcgcaacagtctgtactggcatcaggacaatgacgccgtcagccacctg
atgcgcgtcgccagcggtctggattcactggtgctgggcgaaccgcaaatcctcggtcag
gtgaaaaaagcgtttgcggattcgcaaaaaggccaccttaacgccagcgcgctggagcga
atgtttcagaagtctttttccgtcgccaagagagtgcggactgaaaccgatatcggcgcc
agcgccgtctccgtcgcgtttgccgcctgtacgctcgcccgccaaatctttgaatcgctc
tcgacggtcactgtactgttagttggcgcgggcgaaaccattgaactggtggcgcgtcac
ctgcgcgagcataaagtacaaaagatgattatcgccaaccgaacccgcgagcgcgcgcaa
gccctggcggatgaggttggcgctgaggttatctcgctcagcgatatcgacgcccgtttg
caggatgccgatattatcatcagttcgaccgccagcccgctgccgattatcggtaaaggc
atggtggagcgcgcattaaaaagccgtcgcaaccagccgatgctgctggtggatatcgcc
gtaccgcgcgacgttgagccggaagtcggcaaactggcgaacgcttatctttatagcgtc
gatgatttacagagcatcatttcgcataatctggcgcagcgtcaggctgcggcggtggaa
gcggaaacgattgttgagcaggaagccagcgagtttatggcctggctacgcgcccagggg
gccagcgagaccattcgggaataccgtagtcagtcggagcagattcgtgacgaactgact
accaaagcgctgtcggcccttcaacagggcggtgatgcgcaagccatcttgcaggatctg
gcatggaaactgaccaaccgcctgattcatgcgccaacgaaatcacttcaacaggctgcc
cgtgacggggatgacgaacgcctgaatattctgcgcgacagcctcgggctggagtag

DBGET integrated database retrieval system