KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2351Help
Entry
SPA2351           CDS       T00219                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00860  Porphyrin and chlorophyll metabolism
spt01100  Metabolic pathways
spt01110  Biosynthesis of secondary metabolites
spt01120  Microbial metabolism in diverse environments
Module
spt_M00121  Heme biosynthesis, glutamate => heme
spt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPA2351 (hemB)
Enzymes [BR:spt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SPA2351 (hemB)
Exosome [BR:spt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPA2351 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AAV78235
UniProt: A0A0H2WRP5
Position
2448397..2449371
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgctgcgcgctatg
tttgaagagacaacacttagcctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtaatgcgtatcccggaaaagcag
ctggcgcgagagattgaacgtatcgcaaatgctggcattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatacctggaaagaagacggcctggtggca
agaatgtcccgcatctgtaagcaaaccgtgccggagatgatcgttatgtccgacacctgc
ttctgcgaatacacctcgcacggccactgcggcgtattgtgcgaacacggtgtggataac
gatgcgacgctggccaacctcggcaagcaggccgttatcgcggcggcggctggagcagat
tttattgcgccctccgcggccatggatggacaagtccaggctatccgccaggcgctggat
gccgccggttttaccgatacggcaataatgtcctactccaccaagttcgcctcttctttc
tacggccccttccgtgaagcagcgggtaccgcgttaaaaggcgaccgcaagacgtatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgaatcactgctcgacgaagcccagggt
gcggattgcttaatggtgaaaccggccggcgcgtatctggacgtgctgcgtgaaatccgc
gaacgcacagagttgccgcttggcgcttaccaggtgagcggtgaatacgccatgattaaa
tttgctgctatggctggcgccatagatgaagaaaaggtcgtgctggaaagtctgggctcg
attaaacgcgccggcgctgatttgattttcagttacttcgcgctggatctggctgagaaa
aatattctgcgttaa

DBGET integrated database retrieval system