KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2501
Entry
SPA2501           CDS       T00219                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Brite
KEGG Orthology (KO) [BR:spt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spt02044]
    SPA2501
Secretion system [BR:spt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPA2501
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AAV78376
UniProt: A0A0H2WRJ4
Position
2600433..2602316
AA seq 627 aa
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSART
QLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPI
PEGENTACQFRSSQDVTLWPLPIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFG
ELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGEPGHFDGELNVNLQHPVAH
EGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGLSAGLQKVQGNVAEIVILLN
RLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRTRPLDYEVFSV
QEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMATNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPP
RPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRS
LIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINT
FSQMTLHSMQRGHVMTWLVRTGQRGSV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggatccacggctactggagtattacaaccgcgaactgagctacctgcgggagaccggt
gctgagttcgccaccctccatcccaaaattgccgcccggctggggatgcagggaaccgat
attgccgacccgtatgtggaacgcatgatcgaggcgttcagctttctgagcgcccgcact
cagctaaaaattgacgccgagtttccccgcttcacacagcggttactggaagtcgtcagc
cccaattacgtcacccccacgccatcgatggcagtggtaaagctgtatcccgatacgcag
gaaggcgacctggcgaaaggggtcaccgtgccgcgcgataccgcgttcgtttcccccatc
ccggaaggcgaaaataccgcctgccagtttcgcagcagccaggacgtcacgctgtggccg
ctgcccatcgaggaggtacgcctgaccgccgcgccgccggatatgcccgccctgcaccgc
tatctgccgcctaatattcatgtcgccggggcattgcgcatcaccctgcgaaccttcggg
gaactgactttcagcgagctggccggtccggcacggctgcccttttacctctgcggcgaa
gaacgcattgcgtcacacctgtttgagctgctgcataccagcgccgtcgccacactggcc
ggtgaacccggtcactttgacggcgaactgaatgtgaatcttcaacacccggtggcgcac
gaagggctggagccagggcaggggctgctgccgctcgcctggaacgtgtttcatgggcat
aatctgctgcatgaatttttcgcctgtccggaacggttttacttcttcaccccgaccgga
ttgtctgccggtctacaaaaggtgcagggcaatgtggcggaaattgttatactgcttaac
cgcctgccgccggactggctgattcatcagacggacgccgcacagttcagcctgttctgt
acgccggtgatcaacctgtttccccgcaccaccacccggattgaagtcactcacagcgtg
acggaacagcatctggtggtggatcgtacccgtccgctggattacgaggtgttttctgtt
caggaagtcgaaggcctggaagcggaaaccacacggaagatgatttttcgtccgctgtat
cacacccgtaataatgacgaaggcaaccacgggcgttatttttcactgcgtcgtgagccg
cgccgctcgtcagaaaacgcccgccgctatggcacccgaaccccctataccggctcggaa
gtcttcctctcgctggttgatcagcatgaagcgccctacccggaaaatctgcgccatatc
accgtcacggcaatggcgactaaccgcgatctgccctgccttattccacgtaatggccgg
gatgatctgaccgtagatgcggcgattccggtggcgggcgtgggtcttatcagaccgccg
cgcccgccgcagccgccgctggctgaacgcgaaatggcctggcggctgatccggcagttg
tcgtttaattatctgccgctggccgatctggatcaccgtaccggcggtcaggcgctgcgc
gatctgctgaatctgtttattccggctcacgacagcccgcagtcgcgccaggtgcgcagc
ctgattggctgcaaaaccaccccggtaacccgccgcctgcccggctccggcctgttggtc
tatggccggggcgtcagttgcgaactgaccgtggacgaagaaggattttccggtatcagt
ccttacctgttcggtctggtgctggaacactatattgcccgccatgtttccattaatacc
ttctcgcagatgacgctgcactcgatgcaacgcgggcatgtcatgacctggctggtcaga
accgggcaacgggggagcgtatga

DBGET integrated database retrieval system