KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2966Help
Entry
SPA2966           CDS       T00219                                 

Gene name
yggV
Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPA2966 (yggV)
Enzymes [BR:spt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     SPA2966 (yggV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAV78804
UniProt: Q5PMK9
Position
3071887..3072480
Genome map
AA seq 197 aa AA seqDB search
MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM
TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDKRQARFHC
VLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTREEKSAI
SHRGQALKLLLDALRNG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagttgttctcgcaaccggcaacgccggtaaagtgcgcgagctcgcgtcgctg
ttaagcgattttgggcttgatgtggtagcgcaaacggaactgggcgttgactccgcggaa
gaaaccggcctgacgtttattgaaaacgcgattctcaaagcgcgccatgccgctaaaatg
accggtctgcccgccattgccgatgactccggtctggccgttgacgttttaggcggcgcg
ccgggtatctattccgcgcgctattctggcgaaaacgcgacagatcagcaaaatctggaa
aaactgctgcatactctacgagatgttccggacgacaaacgccaggcgcgattccattgt
gtactggtttatttgcgtcatgccgaagatcccacaccgatagtctgtcacggtagctgg
cctggcgtcattactcgccaggcggctggaaatggcggatttggctatgatcccattttc
ttcgtaccgtctgaaggcaaaaccgccgcagaactgacccgtgaagaaaaaagcgcgatt
tcccaccgtggacaagcgctcaagctgctgctggatgcgttacgcaatggctaa

DBGET integrated database retrieval system