KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3538Help
Entry
SPA3538           CDS       T00219                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00051  Fructose and mannose metabolism
spt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPA3538 (mtlD)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SPA3538 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AAV79341
UniProt: Q5PLR3
Position
3665411..3666559
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQAALAQ
ISGLDANSDVVAEAVNAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gctgacgcggggatacaactgacgtttgcggatgtaaatcaggtcgtactcgatgccctg
aatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgagcaggtggataccgtt
tccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgacctgattgcccacgtt
gatttaatcactactgccgtgggtccggttgtgcttgagcgtatcgctccggccatcgct
aaagggctggtaaaacgtaaggcgcagggcgtggatgccccgctgaacatcatcgcttgt
gaaaacatggtacgcggcacaacgcagttgaaaggccatgtgatgaatgccctaccggaa
gacgccaaagcatgggtagaagaacatgttggctttgtcgattccgccgttgaccgcatc
gtgccgccttctgcgtcggcaaccaacgatccgctggaagtgacggtagaaaccttcagc
gagtggatcgtcgataaaacccagtttaaaggcgcgttgccaaacattccggggatggag
ttaacggataacctgatggcatttgtcgaacgtaaactcttcacgctgaacacaggtcat
gctataaccgcgtacctcggcaaattagccggtcaccaaaccattcgcgacgccattctc
gatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagcggcgcggtgctgatc
aaacgctacggttttgatgccgacaaacatgcggcatacattcagaaaatcctcggtcgt
tttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggtcgtcagccgctacgcaaa
ctcagcgcgggcgaccgtctgatcaaaccactgcttggcaccctggaatatggtctgccg
catgtgaatctggtcaaagggatcgcggcggcgatgcatttccgtagtgatgaagatccg
caggcgcaggagttggcggctctgattaccgaaaaaggcccgcaggccgcgctggcgcaa
atttccgggctggatgccaatagcgatgtggtggcggaggcggttaacgcatataacgcg
accaaatga

DBGET integrated database retrieval system