KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3953Help
Entry
SPA3953           CDS       T00219                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00561  Glycerolipid metabolism
spt00640  Propanoate metabolism
spt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPA3953 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPA3953 (gldA)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SPA3953 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AAV79716
UniProt: A0A0H2WUF9
Position
complement(4104030..4105133)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGANVIARLGDYLKPMANNWLVVGDKFVLGFAEETLRKSLTGAGLSVE
IAPFGGECSQNEIDRLRAVAEKSQCGAVLGIGGGKTLDTAKALAHFMNVPVAIAPTIAST
DAPCSALSVIYTDAGEFDRYLLLPHNPNMVIVDTQIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLIEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLDIKQDIPAKMRTVAEASCAEGETIHNIPGGATPDEVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcagtcaccaggtaagtatattcagggtgcaaacgtcatcgcgcgt
cttggcgattatttaaaaccaatggcgaacaactggctggttgtgggcgataaattcgtg
ctgggatttgccgaagagacgctgcgcaaaagcctgacgggtgccggtttgtcagtagaa
atcgccccgtttggcggcgaatgttcgcaaaatgagatcgacaggctgcgcgccgtcgcc
gagaaaagtcagtgtggtgccgtactgggtatcggcggcggtaaaacgctggataccgcc
aaagcgctggcgcattttatgaacgtcccggtcgctatcgcgccgaccatcgcctctacc
gacgcaccgtgtagcgcgctctcggttatttatacggatgccggtgagtttgaccgttat
ctgctgctgccgcataacccgaatatggtcattgtcgatacgcagatagtggcgggcgcg
ccggcgcgtctgctggcagccggtatcggcgatgcgctggcgacctggtttgaagcgcgc
gcctgctcacgcagcggcgccaccacaatggcgggcggcaagtgtacacaggccgcgctg
gcgctggcggagctatgctataacacgctgatcgaagaaggcgaaaaagccatgttggcc
gccgaacagcacgtcgtcacgccagcgctggaacgcgtcatcgaagccaacacctacctg
agcggggtcggttttgaaagcggcggtctggccgcagcgcacgcgattcataacggttta
acggcgattccggatgcgcaccactattatcacggtgagaaggtcgctttcggtacgctg
acgcaactggtgctggaaaacgcgccggtcgaagaaatcgaaaccgttgcggcactgtgc
cattccgttggcctgccgattacgctggcgcaactggatattaaacaggatatcccggcc
aaaatgcgcaccgtcgcggaagcctcctgcgcagaaggtgaaactattcataacatacct
ggcggcgcaacgccggatgaagtgtacgccgcgctgctggtcgccgaccagtacggtcaa
cgcttcttgcaggaatgggaataa

DBGET integrated database retrieval system