KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891283Help
Entry
100891283         CDS       T01019                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00010  Glycolysis / Gluconeogenesis
spu00562  Inositol phosphate metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100891283
   00562 Inositol phosphate metabolism
    100891283
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100891283
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100891283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Pilin
Motif
Other DBs
NCBI-GeneID: 100891283
NCBI-ProteinID: XP_011671783
Position
Un
AA seq 595 aa AA seqDB search
MHRLAILITVVVCVYGQGPTARYSTKTGYETSFEPGTDEKNQRLRDWQTIASDVGESASV
TGCKPVGVYAVNRHGMRYASDSDIEDYNAILARMKMTGVSEEFAYLLNITDNLYPIALES
SLHPAGFAEMEGLGMRIKQRLPELFVKDGLDGFDFQGTYRQRTVDSAQGFINGLQGPTAN
CSFSSKTPTRDVLTCTFNSTTNSTANTETVAVDHELEGNDLLLKFYESCTKFITDVDDND
AAVIERDRFEEGPELTSAYKAVATKLAPIGWTGPWNMTKSLSSLSKDTLTCTFNSTANST
ANTETVAVDHELEGKDLLLKFYESCTKFITDVDDNDAALMERDRFEEGPELTSAYKAVAT
KLAPIGWTGPWNMTKNDLEVMHHMCGYESAYYGSSPWCNLFLRNESLAVEYWLDLKQYWK
EGYGYDINYQMACPLVDDVVEYMTTVKKNGTRRGSFKFGHSSTLQPFLTILGLYKDTPKL
LANNYDVSVNRAFRSGRISPMTGHVSFNVLQCPSDQYRVLVLHNELPIKLGTCGEFFCPY
DDVVSHLEMSSNGCRFDALCGTNGLYPGVSRADTLSKMSILTLMVTLLVSFFVLQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtctggcaatattaatcaccgttgtcgtctgcgtttacggccaaggtccaaca
gcacgctacagcacgaagaccggctacgaaacaagcttcgaacctgggaccgacgaaaag
aaccagcggttgagggactggcagaccatagccagcgatgtcggggagagcgcctcggta
acgggctgcaagcccgtgggagtgtacgccgtcaaccgccacgggatgcggtacgcgagt
gatagcgacatcgaggattacaatgccatcttggcgaggatgaaaatgaccggcgtcagc
gaggagttcgcctacctgctcaacatcaccgacaacctctacccgatagcgctcgaaagt
tcgctccaccctgccggcttcgctgaaatggaagggttgggtatgaggatcaagcaacgt
ctgccggaactcttcgtcaaagatggcctcgacgggttcgacttccagggcacgtataga
caacggaccgtcgacagcgcacaaggtttcatcaacggtctccaaggtccgacagctaat
tgttccttctctagcaaaacacctacaagggacgtgttgacgtgtacatttaattcgacc
acgaattcgacggcgaacactgaaaccgtagcggtcgaccacgagcttgaaggcaacgac
ctcctcctgaagttctacgagagctgcacgaagtttatcaccgacgtcgacgataatgat
gcggcggtcattgagcgcgacaggttcgaagagggacccgaactcacctcggcatacaaa
gcggtggccaccaaactcgccccaatcggatggacgggaccatggaacatgaccaaaagc
ttaagctctttgtcaaaggacacgttgacgtgtacattcaattcgacggcgaattcgacg
gcgaacactgaaaccgtagcggttgaccacgagcttgaagggaaagacctcctgctgaag
ttctacgagagctgcacgaagttcatcacggacgtcgacgacaacgatgcggcgctcatg
gagcgcgacaggttcgaagagggacctgaactcacctcggcctacaaagcggtggccacc
aaactcgccccaatcggatggacgggaccatggaacatgaccaaaaacgaccttgaagtg
atgcatcacatgtgcggctacgagagcgcgtactacggttcttccccctggtgtaacctc
ttcttaagaaacgagtccttggccgtggaatattggctcgatctcaagcaatactggaaa
gaaggttatggctacgacatcaattaccaaatggcgtgcccactcgtcgacgatgtcgtc
gagtatatgacgactgtgaagaaaaatggcacccgcagaggaagtttcaagttcggccat
tcgtcaactctccagccgttcctgacaatactcggtctctacaaggacactcccaaacta
ctcgccaacaactacgacgtcagcgtcaaccgcgcctttcgcagcggccgtatctcgccc
atgaccggtcacgtcagcttcaacgtccttcagtgccccagcgaccagtaccgcgtgctc
gtcctccacaacgaactcccgatcaagctcggcacctgcggggaattcttctgcccgtac
gacgacgttgtttcgcacctcgagatgtcttcgaatggttgtcggttcgatgcgctctgc
gggacgaacggcctctacccgggcgtcagtcgagccgacactctttcgaagatgtccatt
ttaactctgatggttactctcctcgtgtctttctttgtattgcaataa

DBGET integrated database retrieval system