KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373204
Entry
373204            CDS       T01019                                 

Gene name
CVp18
Definition
(RefSeq) 18kDa egg cortical vesicle protein precursor
  KO
K23284  C1q-related factor
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spu04131]
    373204 (CVp18)
Membrane trafficking [BR:spu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    373204 (CVp18)
SSDB
Motif
Pfam: C1q
Other DBs
NCBI-GeneID: 373204
NCBI-ProteinID: NP_999641
UniProt: Q9GQV4
AA seq 185 aa
MSGASVFHILFGSCIALLFVLNKPVSGDFKYERTIAFTVERTADMSDSTTSRDIGAFNKN
SQKIYLNIGEALDVVTGRFKVPLEGVYYFYYSFSSETMDEETRVELFKLEAGKDLKSATL
QVFQSITPALVSPLDSASASVMVELKRDDEVFLRLAPGLLDADADRPLLFTGYLVYREGQ
QALGY
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcgggcgcatctgtcttccacatcttgttcgggtcatgtatcgctctcctgttcgta
ttaaacaaaccagtgtcgggtgacttcaagtatgagaggactatcgcgttcaccgtggag
cggacggccgatatgagcgactcgacgacctcgagggacatcggggcgtttaacaagaac
tcgcagaagatctatctcaacatcggtgaagcgctggatgtcgtcacaggacgattcaaa
gtcccactggaaggcgtttactacttctactacagcttttcgagtgagacaatggatgag
gagacccgagtcgaactcttcaaactcgaagctggaaaggatcttaaatccgcgactttg
caggtcttccagagcatcacccctgccctcgttagcccgctcgactccgccagcgcctcg
gtcatggtagaactgaaacgcgacgacgaggtttttctgcggttggcaccgggtttgctg
gacgcggatgcggatcgaccgctgcttttcaccggatatttggtgtacagagaaggccaa
caagctcttggatactga

DBGET integrated database retrieval system