KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373483
Entry
373483            CDS       T01019                                 
Symbol
NCKX
Name
(RefSeq) testis potassium dependent sodium/calcium
  KO
K13752  solute carrier family 24 (sodium/potassium/calcium exchanger), member 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spu02000]
    373483 (NCKX)
Transporters [BR:spu02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   373483 (NCKX)
SSDB
Motif
Pfam: Na_Ca_ex DUF3671
Other DBs
NCBI-GeneID: 373483
NCBI-ProteinID: NP_999790
UniProt: Q8T8P0
AA seq 652 aa
MQSHEIAVQSEPVRRTGRLRKPPWRHRVGLGGRDKSKIGTLNKQWLSRTSIVVAFFLISS
ILYITSNRASDMQDKYQSDGNMGRSLLSNESGGHVRPPWETCSFESANQPVLWVIFYAIF
VIILFIAIAIICDDFFVPSLEVISETLSLSEDVAGATFMAAGSSAPELFTAVIGVAFESD
VGVGTIVGSAVFNILIIIALTAALAGQVLNLDWRPLARDSFFYGLSLVCFIVFSWDTEFT
WWESLILVILYVIYLILMKVNPIIMDKTKHITCGGFCRNEVAPLDAEAGEAVGETAVQTV
TDGPENPGQNGTANGNALPRKLPPLQAHELSEENRKISVLSNQSLAVPGNNHIFHHVKHG
ELSSNFRRQSLVDGLNHPHHHHHHHDEHDGDHKPHAQGEKEEEEDKKSEDSEEEPTLRPL
PCLPAINMYYPDKEILESTCGCLRYSLKWLLFVISFPFMCAFSWTIPNCSVPRLRKWYVA
SFLLSIFWIAALSFGMVTLVVKIGCILNISDYTMGLVIVAVGTSVPDALSSILVARDGYG
DMAVSNAIGSNVFDINLGIGLPYLIRIAINGGTNIALLNPADQLRFDDGAFGPIPPHAKF
GFILLLILLFTIFAFTAVRFRLNAVIGVSFAIMYVLFMVYAFVQEIVCDGGC
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcaatcacatgaaatagcagtccaatccgagcctgtgagacgaactggccgcctcagg
aaaccaccatggcgccaccgggttggactagggggacgggacaagagcaagatcggtaca
ctcaacaaacagtggctatcaagaacctccatcgtagtcgcattttttctcatctcttcc
atactatacatcacatcaaacagagcatctgatatgcaagacaaataccaatcagatggt
aacatgggtaggagtttattgtcgaatgaaagcggcggccatgtaagaccgccctgggag
acatgcagcttcgaatccgctaatcaaccagtactctgggtgatcttctatgctatattt
gtcatcattttgttcatcgcaatcgcaataatttgcgatgacttctttgtgccttcgctg
gaggtgatctcggagaccctcagcctatcggaagatgtcgccggagcgaccttcatggcg
gcgggatcgtcagctccggagctcttcacagccgtcatcggtgtcgccttcgaaagcgat
gtcggggtcggcaccatcgtgggatcagccgtgttcaacatcctcatcatcatcgcactc
acagctgctctagctggtcaggttcttaatttggactggcgccctctggcgcgtgatagt
ttcttctacggtctgtccttggtgtgtttcatcgtcttctcttgggacacggagttcacg
tggtgggagtccctcatccttgtcatcctctacgtcatctatctcatcctcatgaaggtt
aatcccatcattatggacaagaccaagcacatcacatgtggtggtttctgtcgcaacgag
gtagctccattggatgccgaggcgggcgaggctgtcggagagaccgcggtacagaccgtt
accgatggacctgaaaaccccggacaaaacggaacagccaacggcaatgccttaccgcgc
aagctaccaccccttcaggcgcacgagctttcggaagagaaccgaaagatatcagttctg
tccaaccagtcgttagcagtaccaggcaacaatcatatattccatcacgtgaaacatgga
gaactgtcttctaactttagaagacagtccctggtagatggcctcaatcatcctcaccac
catcatcatcatcatgatgaacatgacggggaccacaagccacacgctcagggtgagaag
gaagaagaagaggataagaaatcggaggattctgaggaagagccgacacttcgtcccctg
ccctgcctaccagctatcaacatgtactaccctgataaggagatcctggagagtacttgt
ggttgtcttcgctactcactcaaatggttgctgtttgtgattagctttccctttatgtgt
gccttctcatggaccatccccaactgcagcgtgccacgtctcaggaagtggtatgtggcc
tcttttctgctgtccatcttctggattgctgcactcagcttcgggatggtaaccctggtc
gtgaagataggatgtattctcaatatcagtgattacaccatgggtctcgtcatcgtcgca
gtcggaacaagcgtaccggatgccttgagttccatcctagtcgcccgtgatggttacggc
gacatggcagtctccaacgccatcggctccaacgtcttcgacatcaacctcggaatcgga
ctcccctacctcatccgaatcgccatcaacggcggcaccaacatcgccctcctcaaccct
gcagaccagctgcgtttcgacgacggtgcattcggcccgatcccaccccatgccaagttt
ggtttcatcctcctcctcatcctcctcttcaccattttcgctttcaccgccgttcgattc
cgcctcaacgccgtcatcggggtctccttcgccatcatgtacgtcctcttcatggtctat
gccttcgtgcaggagatcgtctgcgatggtggatgctaa

DBGET integrated database retrieval system