KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373521
Entry
373521            CDS       T01019                                 

Gene name
Alx1
Definition
(RefSeq) aristaless-like homeobox protein
  KO
K09451  homeobox protein aristaless-like 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spu03000]
    373521 (Alx1)
Transcription factors [BR:spu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    373521 (Alx1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 373521
NCBI-ProteinID: NP_999809
UniProt: Q7Z0W3
AA seq 430 aa
MLFYPSMPCLATYPSQNKDMIPLTTPSTPNPTPLGPPTGATTTTTTLKPALDSPLTDRSM
DTSTPGLLGGGSSGIHKAEQDSTNNNAGANGKGSDDVKSPMGDPKDDDKNDSDAKRKKRR
NRTTFTSYQLEEMEKVFQRTHYPDVYCREQLALRCDLTEARVQVWFQNRRAKWRKRERFQ
QFQNMRGLGPGSGYEMPIAPRPDAYSQVNSPGFHVLGDSHQPPAPVEGAMLRICRNLQNL
RREFDSRKIGCHPSSSVGGTPGTSTANESQDSSNHSSMIHQASPWATAANMASPLASSMS
PIVQQPQMPGQNPINSCMAPQSNLPSFMGVPAHQMNNAGVMNPMTNMTSMTSMPTSMPPS
SVSAPVSSPSSNFMSSVGGLNPAAYNGQYTEMHPSVEGVGGIDRRTNSIAALRLRAKEHS
SVMGMMNGYS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgttgttttacccctcaatgccgtgcttagcgacgtatcccagccagaacaaagatatg
atccccctcaccacgccctcaacgccgaaccccacgcccctgggtccacctacaggagcc
acgacgacgaccaccaccctcaaaccggccctagactccccgctcaccgaccgcagcatg
gacacctccacaccgggcctcttgggcggtggcagcagtgggatacacaaagccgagcag
gactcgaccaacaacaacgccggcgccaacggcaagggcagcgacgacgtcaagtcaccg
atgggcgatcccaaggatgacgacaagaacgacagcgatgccaagaggaagaagaggaga
aataggacgacgttcaccagctatcaacttgaggagatggagaaggtatttcaaagaacg
cactatcccgatgtgtactgcagagaacagctcgccctcagatgcgatcttacagaggca
cgagtccaggtttggttccagaacaggcgcgccaagtggaggaaaagggaacgcttccaa
cagttccagaacatgaggggactaggaccaggctccggttacgagatgcccatagcgcca
cgcccagatgcctactcacaggtcaattctcccggcttccacgtcctcggtgactcgcac
cagccccccgcacccgtagagggtgctatgctccgaatctgccgaaacctgcagaacctg
cgtcgggaattcgactccagaaaaatcgggtgccacccgtccagttcggtaggaggcacg
ccaggcaccagcaccgccaacgaatcgcaagactccagcaatcactcttcaatgattcat
caagcatcgccgtgggcaactgccgcaaatatggcctcgcccctcgcatcctccatgtcc
ccgatcgtccagcagccccagatgcccggccagaaccccatcaacagctgcatggccccc
cagtccaacctcccctccttcatgggtgtgcccgcccatcaaatgaacaacgccggggtc
atgaaccccatgaccaacatgacctcaatgacctctatgcctaccagtatgccgccctcg
tctgtctccgcaccggtcagcagcccaagctccaacttcatgtccagcgtggggggcctc
aacccggcggcgtacaacggacaatacacagagatgcacccgtccgtcgagggcgtcggt
ggcatagatcgacgtactaacagcatcgcggcactccggctcagggcgaaggagcacagt
tctgtgatggggatgatgaacggttactcgtaa

DBGET integrated database retrieval system