KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575027
Entry
575027            CDS       T01019                                 
Name
(RefSeq) fibrillin-1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_3 FXa_inhibition cEGF CrgA
Other DBs
NCBI-GeneID: 575027
NCBI-ProteinID: XP_030828266
Position
Unknown
AA seq 3513 aa
MTANMWGLRVTLFLLLQGIISTRATVIVTFHLLTYLNPSSKQLDGVCCDGISTDICDTKC
DNKFEICFGPLGNDTTTEDCPFGKYKTRKIHEDRDLFLFPTPLPGGVPNPMIIRIEEWKG
GFRLQMNVMDTNSYYDPEILVDVYRRNFHMRPGRSPVRARKNRMVLDGEGSSRLVIDVKL
YCDSHYYGPECSVFCRPRGDGIDHFYCDPLTGGIICDAGYTGHRCAEEIDECASVPCQNN
GTCHDVVNGFWCTCQEGTTGNVCQTNPDDCQLNECTNGASCVDGYAAYTCICPPGFTGTY
CEFNINECASYPCHNNAICSDGIDGYICLCVPGFTGTHCETDIDECASDPCYNDATCIDR
INKYKCRCVKGYEGEHCEVNINECASDPCQNGATCVDEVNGFECTCNQGYQGKVCHINTD
ECKSNPCFNGGECLDGVNGYNCSCAPGYNGVHCELNIDECASNPCIHDSTCNDLVNGYRC
DCLPGYEGAECQIEIDECNSDPCQNEAPCVDVVNGYICVCLPGYEGPECETDTDECYSDP
CQNDGRCLDRVDGYVCECEEGFEGIHCEINIDECESAPCMNQGTCEDGINGYTCICKPGF
TGLECEINIDECASGPCQNDASCVDGVNGYICECTPGYNGIFCEINIDECASLPCVNGAT
CTDEVNGYTCSCSPGYSNVHCDVEINECASVVCQHGGTCIDHINRYECVCSPGYTGLQCE
IDINECESDPCQNGATCKDRVNGYQCKCSPGYEGPNCEINIDECSSSPCENGASCVDETN
EYTCTCHPGYEGVHCQTDIAECSSDPCQNGALCVDKVNQYRCKCKAGYTGTNCEIEIDEC
SSDPCDNGALCVDEVDGYKCECVPGYTGTHCETNIDECESSPCENGGSCNDDINRFSCSC
LPGYNGRVCQKNIDECASNPCFNNAICADSVNGYYCMCVPGFEGIHCETNVNECQSDPCS
NGALCMDGINGYRCKCAPGFDGVHCENDIDECGSSPCFHGAECIDRVNKYKCRCLLGYAG
THCLVDIDECASGPCLNGASCLDQINQFECVCVPGFEGVTCETDIDECSSSPCQNNATCV
DHINHYTCNCLPGFESTHCHVDIDECSSNPCEHGSSCEDLINGYQCHCRPGYEGVHCEIE
IDECHSDPCLNGATCIDRINKYRCNCLPGYSGVYCEVNVEECESDPCENGGFCEDHVNHF
VCQCQPGFNGMVCEMNIQECESNPCLNNATCVDGIDGYQCDCKPGFEGTHCDVDIDECGS
DPCLNGATCSDKINHYICNCDPGYVGTHCEHEVDECESSPCQNGASCIDRVNKYKCKCLP
GYTGTHCEIDINECDSDPCQNDATCLDRIDEYVCECTPGYEGTHCEVDIDECASSPCMND
ASCEDKVNGYTCHCLAGYEGIHCESEINECSSNPCQNDAVCSNLVNEYECICNPGFTGVH
CEVDIDECMSGPCMNNATCIDRVDRYKCKCVPGFEGIHCETNINECESSPCRNNGVCVDE
INQFTCQCLAGFQGILCEVNIDECSSMPCQNNATCLDEINRYSCECLPGFKGIHCETDID
ECASSPCENGATCIDNINGFYCNCVPGYIGTFCETDVDECESDPCQNGALCVDRVNRYKC
RCLDGFEGTHCEVNIDECGSNPCFNGAPCIDMIDAFECTCVPGFAGVTCETNINECTSEP
CFNDGRCVDLVAGYICECLEGFNGRHCNNDIDECDSSPCLNNATCIDQVDEYVCRCWPGY
EGIHCGIDIDECTSSPCEHGATCVDMINGYECECLPGYEGILCGIDTDECDSDPCQNAGT
CIDRVNKYKCKCRPGFEGNECEVDINECSSDPCSNGATCRDEINGFVCECTAGFEGIHCE
VDIDECESGPCENGATCVDQVNGYSCSCDLGYDGILCEINIDECGSNPCLNGASCLDKIN
GYMCQCADGYDGILCENNIDECASAPCYNDGKCKDKVNGYMCKCQEGFEGVHCENDIDEC
FSSPCMNSANCVDSVAGYQCECSPGYTGIHCETDIDECASSPCENGATCMDEVNGYTCSC
VPGYRGVLCEVDINECASDPCHNNATCVDKVDRYKCICVAGFRGKECQSNFDECTSNPCL
NDGQCEDGVNDYVCHCQPGYTGDLCEIDIDECQSSPCQNDALCIDQINGFTCDCEDGYDG
TLCSTDINECSSQPCLNNGSCTDFVNRFECSCVPGFEGTLCGENINECRSNPCLNNGECI
DDINMYFCRCAAGFEGVQCEIEIDECSSNPCQNDARCLDHVNGYNCECVPGYESTYCEIN
TDECLSDPCLHGATCHDMINEYQCLCRAGYNGANCENNINECISEPCFNDGICMDKVNRY
KCLCQDGFEGVHCEVNIDECASDPCMNAGVCFDQVNSYQCLCQPGFTGVHCEIDIDECSS
EPCQNKADCLDFISRYECQCKPGYEGIHCETDVNECESNPCFNGATCTDKVNRFRCSCLP
GYAGELCEIDINECQSSPCQNGARCQDQINGYVCLCPFGFDGAQCEVDIDECASSPCYNG
GLCLDRVNGYECQCIAGFTGVGCETNINECLSNPCQYDSECVDHVNGYSCICNPGTEGTH
CEIDIDECSSQPCQNGARCKDGMNGYRCRCAVGYDGMHCEVDIDECASSPCQNMAPCIDL
VDGYSCDCRPGFSGTHCEININECVSEPCANGGTCRDQINGYICGCLLGYDGIHCENDID
ECESSPCQNGANCLDNIDQYICECLDGFMGTNCQVDINECASYPCRNGGTCFDKVNGYNC
FCDSGFEGSKCQVNIDECESSPCLNGGYCIDQINSFMCRCDAGFEGTFCEINIDECASDP
CKFASTCYDKIDGYGCECLPGYYGVHCQFELDECVSAPCGHGGQCINEVNGFTCDCAAGY
EGVTCEVDIDECNSQPCQNGGTCFDGINGYDCECVEGFGGNDCQIDIDECASIPCQHGGT
CQDLINGYSCTCIVGFEGAHCETNINECESNPCSSYGRCIDGVNRYRCRCRPGFMGAHCE
IDIDECQSDPCYHGSRCVDGLNGYTCQCRSGYQGSRCRDEVDECISSPCINGLCLDRLNG
YRCHCIKGFYGRNCEVNRDECISDPCLNGATCQDAINGYNCQCPIGYEGDHCEIITDECQ
SDPCQNNATCVDGFKEYTCECVLGFEGINCEININDCASDPCQYRSTCLDGIDSYECQCV
LGYKGEHCEFEINECDSQPCKNDGTCLNGVNSFYCYCPPGFEGWLCEIQIDECESDPCLH
GGSCIDLTAGFICQCEEGFSGIRCEAVLDQCKLNPCYGNATCVTRTDDFRCLCPPGYSGL
GCEDYDEDGCGSTKCFDGQCLIDRVTDDDVIYSCKCNRGFIGTECQTYLLNITASLLIEE
KHSQLSGLEYKMKEVLMEAMGKTEDIHNCSNVDIAIIDTTTGNGALSGMEFTNVTIYAML
DDKPADRDSLSLMLRALPQAHVNKLIHPYRLFVDKQMPPDVKIEISVNKNNKKKSWGQRH
WYAFFIIILILIGVVSAVVYIVRRQRKAEIPPD
NT seq 10542 nt   +upstreamnt  +downstreamnt
atgacagcaaacatgtggggccttcgtgtgacgctatttctacttcttcagggcataatt
tctacccgagcgaccgtaatcgtgacgtttcatctcctaacatacctgaatccttcaagt
aagcagctcgatggtgtctgttgcgatggcatctctacagacatatgtgataccaagtgc
gacaacaaatttgaaatatgcttcgggcctcttggaaacgacactaccactgaagactgt
ccttttggaaagtataaaacaaggaagatacacgaggatcgggacctgttcctctttcct
actccactccctggtggtgtacccaacccgatgatcatcaggattgaagaatggaaggga
ggttttcgactgcaaatgaatgttatggataccaactcctactacgatccggaaatactg
gtcgatgtctacaggcgcaacttccatatgcgacctggaaggagtccggtacgagctcgt
aagaacaggatggttcttgatggagaaggctcttccaggcttgttatagacgttaaacta
tactgtgattcacattactatggtccagagtgttctgtcttctgccgaccccgaggagat
ggaatcgatcacttctactgtgaccctctaacaggaggtatcatttgtgatgctggttat
actggacaccggtgtgcagaggaaatcgatgaatgcgcttcggtgccatgtcaaaataac
ggaacttgccacgacgtggtgaacggcttttggtgtacatgtcaagagggtacgactggc
aatgtgtgtcaaacgaatcccgacgactgtcaactgaacgagtgtacaaacggagcgtca
tgtgtcgatggatatgccgcttatacctgcatctgtcccccagggttcactgggacatac
tgcgagttcaatatcaacgaatgtgccagttatccttgtcacaacaatgctatctgctcc
gacggtattgatggatatatctgtctctgtgttcctgggtttaccggtactcattgtgag
actgacatcgatgaatgtgcaagtgatccctgttacaacgatgccacttgtatagacaga
attaacaagtataaatgtagatgtgtcaaaggctatgaaggagaacattgcgaggttaat
atcaacgaatgtgccagtgatccttgtcaaaatggagcgacctgtgttgatgaagtcaat
ggctttgaatgtacttgtaaccaaggatatcaaggaaaagtctgccatattaacacggac
gaatgtaaaagtaatccatgttttaacggaggggaatgcctagatggggttaacggctac
aattgtagttgtgctcctgggtacaatggagtacactgcgagttaaacattgacgaatgt
gcaagtaatccttgcattcatgacagcacctgcaatgatcttgtcaatggatatcggtgt
gattgtctaccggggtacgaaggtgcagaatgtcagattgaaatagatgaatgcaacagt
gatccttgccaaaatgaagcaccgtgtgtcgatgttgttaatggatacatatgtgtgtgc
cttcccggatacgaaggacccgaatgtgagacggataccgacgaatgttacagcgatcct
tgtcaaaatgatggcagatgtctcgatagagtcgatggatacgtatgcgaatgtgaagaa
ggtttcgaaggaattcactgcgaaattaacatcgatgaatgtgaaagtgcaccttgtatg
aaccaaggaacatgtgaagatggaataaatggatacacctgcatttgcaagccaggattt
acaggattggaatgtgaaattaacatcgacgaatgtgcgagtggtccatgtcaaaatgat
gcctcttgtgttgacggagtgaatggttacatctgtgagtgtacaccaggatataacggt
atcttctgtgaaatcaacatagatgagtgtgcatctttgccttgcgtgaatggtgcgaca
tgcacggatgaagttaacgggtatacatgtagttgtagtccaggatacagcaatgtccat
tgtgatgtagaaataaacgagtgcgcaagtgttgtttgccaacatggcggaacatgtatt
gatcatatcaatcggtatgaatgtgtatgttcacctggatacactggcttacaatgcgag
attgatataaatgaatgcgagagtgacccatgtcaaaatggcgcaacttgcaaagaccgc
gttaatggataccagtgtaaatgctcaccaggttacgaaggaccgaactgtgaaattaat
attgacgagtgttccagctcaccatgtgagaatggtgcttcttgcgttgatgaaacgaat
gagtatacgtgcacgtgtcaccctggatatgaaggagtacattgtcaaacggacattgct
gagtgttccagcgacccctgtcaaaacggtgcactctgcgttgacaaagtcaatcaatat
cgatgcaaatgcaaggcaggatacacaggaacaaactgtgagattgaaatagacgagtgt
tcaagcgacccttgtgacaacggtgctctgtgcgttgatgaggtagacggatataaatgt
gaatgtgtcccgggttacacagggacacactgtgaaaccaacattgatgagtgtgaaagc
tccccttgtgagaatggaggatcttgtaatgatgatatcaatcggtttagctgcagttgt
ttacctgggtacaacggacgagtatgtcaaaagaatattgatgaatgcgcaagtaatcca
tgcttcaacaatgccatatgtgcagattcggtaaatggatactactgcatgtgtgttccc
ggctttgagggaatacactgtgaaacaaacgttaacgaatgccagtctgacccctgttcc
aatggggccttgtgtatggatggtatcaatggttacagatgtaaatgtgctcctggtttt
gatggggtacactgtgaaaatgacattgatgaatgtggaagctctccttgtttccatggt
gccgaatgtattgaccgtgtcaataaatacaagtgtagatgtctcctcggatatgcaggt
acacattgtttagtggatatcgatgaatgtgctagcggtccttgtttgaatggggcctcg
tgtctagatcaaatcaatcagtttgaatgtgtttgtgtccctggatttgagggagtcacg
tgcgaaactgacatagatgaatgctctagctctccatgccagaataacgctacatgtgtg
gaccacatcaaccactacacctgtaactgtttgccagggttcgaaagcacacattgccat
gtagacattgatgaatgttcaagtaatccatgtgaacatggatcctcttgtgaggacctg
atcaatggttatcaatgccactgccgtcccggatatgaaggagttcattgcgaaattgaa
atagacgagtgccatagtgatccctgtttgaacggtgcaacctgcatagaccgaatcaac
aagtataggtgcaattgcttacctggctactcaggtgtttattgtgaagtaaacgtggaa
gaatgtgaaagcgacccttgcgaaaatggaggattttgtgaagaccacgtcaaccatttc
gtttgccagtgccaaccaggattcaacgggatggtttgtgagatgaatattcaagagtgt
gaaagcaatccatgtttgaataatgccacgtgtgttgacggtatcgatggatatcaatgc
gactgcaaacccggctttgaaggaacacactgtgatgtagacattgacgagtgcggatct
gatccttgtctaaatggagccacttgttctgacaagataaaccactatatctgtaactgt
gatccaggatacgttggtactcactgcgaacatgaagttgatgaatgcgaaagctcacct
tgtcaaaatggtgctagctgcattgatcgtgtgaacaaatacaagtgtaaatgcttacca
ggatatactggtacccactgcgaaattgatatcaatgaatgcgattcagacccatgccag
aatgatgccacctgtctggataggatcgatgagtacgtttgtgaatgcactccgggatat
gaaggaacacactgtgaggttgacattgatgaatgcgcaagctcaccttgcatgaacgac
gcatcatgtgaagacaaagtgaatggatacacgtgccattgcttagcaggatatgaagga
atacattgtgaatcagaaatcaacgaatgctctagcaatccgtgtcagaacgacgctgtc
tgttccaacctcgttaacgaatatgaatgcatttgcaaccctggctttacaggtgtacat
tgcgaggtggatattgatgaatgcatgagcggcccttgcatgaacaacgcaacttgcata
gaccgtgtggataggtacaaatgcaaatgtgtcccaggatttgaaggaatccactgtgaa
actaacattaatgaatgtgaaagctcaccatgtcgaaacaacggcgtctgtgttgatgaa
ataaatcaatttacatgccagtgccttgctggctttcaaggtatcctttgtgaagtaaat
atagatgaatgcagtagcatgccttgccagaataatgccacatgtctcgatgaaattaat
agatattcctgtgagtgtcttccaggctttaaagggattcactgtgaaacggatattgat
gaatgtgcgtcatcaccatgtgagaatggagcaacatgtatagacaacatcaatggattt
tactgcaactgcgttccaggatacataggaacattctgtgaaacagacgttgatgagtgc
gaaagtgacccatgccagaatggggcactttgtgttgatcgagtgaacagatacaaatgt
cggtgtttggacggttttgagggtactcactgcgaggttaacatagatgaatgtggcagc
aacccgtgttttaatggtgccccgtgtatcgacatgatagatgcattcgagtgtacttgt
gttccaggatttgcaggagtgacttgtgaaacaaatattaacgaatgcacaagcgagcca
tgttttaatgatggaagatgtgtagacttggttgccggatacatatgcgaatgccttgag
ggattcaatggacgtcactgcaataatgacatagacgaatgtgatagtagtccgtgtttg
aacaatgcaacttgcatcgaccaagtggacgaatatgtgtgccgatgttggccaggttat
gaaggtattcactgcggaattgacatcgatgaatgtacctcatcaccatgcgaacatgga
gctacttgtgtagatatgataaatggctacgaatgtgaatgcctacctggatatgaagga
atcctttgtgggatagatacagatgaatgcgatagtgatccctgtcaaaacgcgggaact
tgtatcgaccgagtgaacaaatataagtgcaaatgccgacctggctttgaaggaaacgaa
tgtgaagttgatatcaatgaatgcagcagtgatccttgtagtaatggagcaacttgccgg
gacgaaatcaatggattcgtttgtgagtgtactgctggatttgaaggaattcattgtgag
gtggacatcgacgaatgtgaaagcggaccttgtgaaaatggtgctacatgtgtggatcaa
gtgaatggatattcttgtagttgtgaccttggatacgatggcattctctgtgaaattaac
atcgacgagtgtggaagtaacccatgcttgaatggtgcgagttgtctcgataagatcaat
ggatacatgtgccaatgtgcagatgggtatgatggcatcctctgtgagaacaacatagat
gagtgtgctagtgcaccttgttacaacgatggcaaatgtaaagacaaggtaaacggttac
atgtgtaaatgccaagaaggatttgaaggagtgcactgtgaaaatgacattgacgagtgc
ttcagttctccatgtatgaattcagcaaattgtgtagattctgttgctggataccagtgt
gaatgcagtcctggttatacgggtatccattgtgaaacagacattgatgagtgtgccagt
tctccttgtgaaaatggagctacctgcatggatgaggttaatggatacacctgttcatgt
gttccaggttaccgaggtgtcctttgtgaagtcgatataaacgaatgtgccagtgatcca
tgccacaacaatgctacatgcgtggataaagtcgacagatataaatgcatttgtgttgct
ggttttcgtggtaaggaatgccaatccaactttgatgaatgcactagcaatccgtgtttg
aacgacgggcaatgcgaggatggcgtaaatgattatgtatgccattgtcaaccaggctat
accggtgatttgtgtgaaattgacattgatgaatgccaatcatcgccttgtcaaaatgac
gctctctgtattgaccaaatcaacgggtttacttgtgactgcgaggatggttatgatgga
accttgtgctcaactgatatcaatgaatgttccagtcaaccttgtttgaataacggaagt
tgcactgactttgtaaatcgatttgaatgcagttgcgtaccagggttcgaagggacacta
tgtggagaaaacataaatgaatgcagaagcaacccatgtttgaataatggtgagtgtatt
gacgacatcaatatgtatttctgcagatgcgctgctggatttgaaggtgtacaatgcgaa
attgaaattgatgaatgttctagcaatccttgccaaaatgatgcccgctgccttgatcat
gtgaacggctacaactgtgaatgcgtaccaggttatgaaagcacctattgtgagattaat
actgacgaatgtttgagtgacccatgcttacatggagcgacttgccatgacatgattaac
gaataccagtgtttgtgccgagcaggatacaatggtgcgaattgtgagaataatattaac
gaatgtatcagcgagccatgttttaatgatggcatctgcatggacaaagtcaaccgatac
aaatgcttgtgtcaagatggatttgaaggagtccattgtgaagttaatatcgatgagtgc
gcaagtgatccctgcatgaatgctggtgtgtgttttgaccaggttaatagctatcagtgt
ctttgccaaccgggattcacgggcgttcattgcgagatagatatcgacgaatgtagtagc
gaaccatgccaaaacaaagcagactgtcttgatttcatatccagatatgagtgtcaatgt
aaacctggatatgaaggtattcactgcgaaacggacgtcaacgaatgtgagagcaatcct
tgttttaatggtgctacatgcacagataaagtgaatcggtttaggtgttcctgtcttcct
ggatatgcaggagagttgtgtgaaatagatataaatgaatgccagagctcaccttgccaa
aacggagccagatgtcaggaccagatcaatggatatgtatgtctttgcccttttggattc
gatggagcgcaatgcgaagttgatattgacgaatgtgctagttctccttgttacaatggg
ggactttgcctggacagagtcaatggatatgagtgccagtgcattgccggttttaccggt
gtagggtgtgaaacaaatatcaatgaatgtttaagtaacccatgccaatatgactctgaa
tgcgtagatcatgtcaatggatatagttgcatatgcaatcccggaactgaaggtactcat
tgcgagattgatatcgatgaatgctcaagtcagccatgccaaaatggggcacgatgcaaa
gatggtatgaatggatatagatgtcgatgtgctgtcgggtacgacgggatgcattgcgag
gtcgacatagacgagtgtgcgagctctccttgtcaaaacatggcaccgtgtatagattta
gtggatggatactcttgtgattgtagaccaggattttcaggtacacattgtgaaataaat
atcaacgaatgtgtaagtgagccttgtgctaatggagggacctgtagagatcagattaat
ggatacatatgtggctgtcttttaggatatgatggtattcattgtgaaaatgatatagat
gaatgtgaaagctcaccttgtcagaatggagccaactgtttggataacatcgaccaatac
atatgcgagtgtttggacggattcatgggaaccaattgccaagtagatatcaacgaatgt
gctagctatccttgtaggaacggcggaacatgctttgataaagtaaatggatacaattgt
ttttgtgattcagggtttgagggatctaagtgtcaagtgaatatcgatgaatgcgaaagt
tctccttgtctcaatggagggtactgcatagatcagatcaattcattcatgtgccggtgt
gatgcaggatttgaaggaaccttctgcgagatcaatatcgacgagtgcgcaagtgaccca
tgtaagtttgcatctacctgctatgacaaaattgacgggtatggatgtgaatgtctccca
ggctattatggtgtacattgccagtttgagctagacgaatgtgtgagcgcaccatgcggt
catggtggacagtgcatcaacgaagtaaatggattcacctgtgactgtgctgcgggatat
gaaggtgtcacttgtgaagttgacatagatgaatgcaacagccaaccctgtcagaacggt
ggaacatgctttgatggaatcaatggatacgactgcgaatgtgtcgagggttttggtggt
aacgactgtcaaatagatatcgatgaatgtgcgagcattccatgccagcatggtggtacc
tgtcaggaccttataaatggatatagctgtacctgcatagtgggttttgaaggtgcccat
tgcgaaacgaatatcaacgaatgtgaaagcaatccttgttcaagctatggaagatgcata
gatggggtgaataggtatcgatgcagatgtcgtccagggttcatgggtgctcattgtgag
attgatattgatgagtgccagagtgatccatgttaccacggcagcaggtgtgttgatggc
ctgaacggatacacgtgccaatgcagatctggttaccaggggtcgcgctgtcgagatgag
gtcgatgaatgtatcagtagcccgtgcataaatggcctttgccttgatagattaaatgga
taccgctgtcattgcattaagggattttatggaagaaattgtgaagtaaatcgcgacgaa
tgcatcagtgatccctgtcttaatggtgctacttgccaggatgcaatcaatggctataac
tgccaatgtcccataggatatgaaggagaccactgtgaaatcataaccgatgaatgtcag
agtgatccttgtcaaaataatgcaacctgtgtggatggatttaaagaatatacatgtgaa
tgcgttcttggcttcgaaggaatcaattgtgaaataaacattaacgactgtgctagtgac
ccttgtcaatatagatcaacttgcctcgacggaatcgacagttacgaatgccaatgtgtt
cttggttataaaggtgagcactgtgaatttgaaatcaacgaatgtgacagccaaccatgc
aaaaatgatggaacctgcctaaatggtgtgaacagtttctattgctattgcccaccgggc
tttgaaggttggttatgtgagatacaaatagacgaatgcgaaagtgatccttgtcttcat
ggtgggagttgtattgatctaactgcgggattcatctgtcaatgtgaagaaggattctcg
ggtatccgatgcgaggctgttcttgatcaatgcaagctcaatccttgctatggaaatgct
acatgcgtcaccagaactgacgatttcaggtgcctctgtcctcctggatattcgggtctg
ggttgtgaagactatgatgaggacggttgtgggtcgaccaagtgcttcgacggtcagtgt
ttgatcgatagagtaactgacgatgacgtcatatatagctgtaaatgcaaccgtggattt
attggaactgaatgccagacatatttactgaacatcacagctagcttgctgattgaggaa
aagcactcacaactgagcggcctggagtacaagatgaaggaagtactaatggaagccatg
gggaagactgaggacatccataattgttccaatgtggacatcgctataatagacacgacg
acaggcaacggagccttatcaggaatggaatttacgaacgtaacaatctacgccatgctg
gatgataagcctgccgatcgcgattctctatcactgatgctgagagctcttcctcaagcc
catgtcaacaaactcatccatccttatcgcctctttgtcgacaagcagatgccacctgat
gtgaagatagaaatcagtgttaataaaaataataagaagaagtcatggggacagcggcat
tggtatgctttcttcattatcatccttatcctcatcggagtcgtgtccgcagtggtatac
atcgttaggaggcagcggaaagctgaaattccacccgactga

DBGET integrated database retrieval system