KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576010Help
Entry
576010            CDS       T01019                                 

Definition
(RefSeq) autophagy-related protein 16 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04136  Autophagy - other
spu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:spu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    576010
   04136 Autophagy - other
    576010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spu04131]
    576010
   03029 Mitochondrial biogenesis [BR:spu03029]
    576010
Membrane trafficking [BR:spu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    576010
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    576010
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    576010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Ge1_WD40 CCDC92 Cnn_1N
Motif
Other DBs
NCBI-GeneID: 576010
NCBI-ProteinID: XP_030837977
Position
Unknown
AA seq 588 aa AA seqDB search
MALKINMATSMDPSMSWKKTIQMRIRRRNEKESIPFKALFETHLRLANQIEASRSQNVQL
HVQVERLQQENTDLQSKGLSSSPGPVENVGKGSAAYRQLEQKCFKLNEELTDVHRKKGEN
AQQLIDLTALLKTKESELQKNEESLNEALIRVGAYEDEIRNLEMAVLELRKTNEDLRDEL
QNMTLLCSKNEESLYRLQAENAELVTRVMDEKGRDADILNSTNAIIQEVLNDKMKKALEE
AASETPTPMPEPKSSIGEGRKLLRPGSMSASTLSRAPSLPPPVSFVMSVPDKNIAQFEAH
DGEVHTVKFCPSGAFFATGGADRKLKLWEFLNNSCQNSAVLFGSNLAVTCIDFDDQENLI
LGAANDCTIRIWGTHDHRLRQTLTGHSNKVLAAKFLSDPNKFVSGSHDRTLKIWDLRSRA
CTRTMFAGSMCNDLVTSDGAGTNIISGHVDKKIRFWDARSNARTKEILLNGKVTSLDLSP
DRQSLLACTRDDALKIVDLRTNQVITSCSAEGFKVACDYTRAAFSPDGEYVTAGSQDGSI
FYWKAKNGEMEKQIKDHKGPVICVSWHPSCRQLISCDRAKNVILWADF
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaaagatcaacatggcgacttccatggacccttcgatgtcatggaaaaagacg
atacaaatgcggataagaaggagaaacgaaaaagagagcattccattcaaagcattgttt
gaaacacatttaagacttgccaaccagatcgaggcatcccggtcgcagaacgtccagctc
catgtccaggtggagcggctccagcaggagaacacggatctccagtccaaaggactctca
agtagtcccgggccagtggagaacgttggtaaaggcagcgctgcttatcgtcagctagaa
cagaagtgcttcaagctgaacgaggaactcaccgatgtacatcgaaagaaaggagagaat
gcccagcaactgattgatctcacagccttactcaaaacaaaggagtctgagttacagaag
aatgaagaaagtttaaatgaagccctcatcagggtcggtgcgtatgaagatgaaatcagg
aaccttgaaatggcagtgctagaactgaggaaaacaaatgaggacttacgagacgagtta
cagaacatgacgctgctgtgcagcaagaatgaagaatccctctacagactgcaggcggag
aacgcggagctggtgacacgggtgatggacgagaaggggcgagatgcagacattctgaac
agcaccaacgccatcatccaggaggtccttaatgacaagatgaagaaggctctggaggaa
gctgcttccgagacacccaccccgatgccagagccaaaaagcagcatcggtgaaggcaga
aaattactcaggccaggctcaatgtctgcatccaccctatcaagggcaccaagcttgcca
cccccggtctccttcgtcatgagtgtgccggacaaaaatatagcacagtttgaagcgcat
gatggggaggttcacacagtcaagttctgtccttcgggggctttcttcgccactggtggt
gctgacagaaaactcaagctgtgggaattcctgaacaattcttgtcaaaatagtgctgta
ctcttcggcagcaaccttgcggtgacgtgtatcgacttcgacgatcaggaaaatctcatt
ctcggggcagccaacgactgcaccatcaggatatggggaacacatgatcacaggttacgg
caaacattaacgggtcatagcaataaagttttagctgcaaaattcctgagcgatcccaac
aagtttgtttccggtagccacgacaggactctcaagatctgggatctcaggagcagagca
tgtacccgaacaatgtttgcaggttccatgtgcaacgatcttgtaacgagtgatggagca
ggaaccaacataatcagtggtcacgtggacaagaagatcaggttctgggatgcaagatca
aatgcaagaacgaaagagatcctactcaacggcaaggtgacctctcttgacctttcacct
gatcggcaatccttattagcgtgcacgagagatgacgcgctgaagatagtggatcttcgc
accaatcaagttatcacatcttgtagtgcagaaggattcaaagtggcatgcgactacacc
agagcggccttcagccccgacggtgaatacgtgacagcaggctcacaagacggctcaata
ttctactggaaggcaaagaacggagaaatggagaagcagatcaaggaccacaagggacca
gtgatatgtgtgtcatggcatccatcctgcagacaactcatcagctgtgatagggccaag
aatgtcatactttgggcggacttttga

DBGET integrated database retrieval system