KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576642Help
Entry
576642            CDS       T01019                                 

Definition
(RefSeq) heat shock 70 kDa protein IV-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03040  Spliceosome
spu04141  Protein processing in endoplasmic reticulum
spu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    576642
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    576642
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    576642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    576642
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spu03041]
    576642
   03009 Ribosome biogenesis [BR:spu03009]
    576642
   03110 Chaperones and folding catalysts [BR:spu03110]
    576642
   04131 Membrane trafficking [BR:spu04131]
    576642
   03051 Proteasome [BR:spu03051]
    576642
   03029 Mitochondrial biogenesis [BR:spu03029]
    576642
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spu04147]
    576642
Protein phosphatases and associated proteins [BR:spu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     576642
Spliceosome [BR:spu03041]
 Complex B
  Other components
   Prp19 complex
    576642
 Complex C
   Prp19-CDC5 complex
    576642
Ribosome biogenesis [BR:spu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    576642
Chaperones and folding catalysts [BR:spu03110]
 Heat shock proteins
  HSP70 / DNAK
   576642
Membrane trafficking [BR:spu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    576642
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    576642
Proteasome [BR:spu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    576642
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    576642
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   576642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 576642
NCBI-ProteinID: XP_030833416
Position
Unknown
AA seq 633 aa AA seqDB search
MSNPTAIGIDLGTTYSCVGVFQNGRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPRNTIFDAKRLIGRRFDDTAVQSDMKHWSFTVTNNGGKPMLQAEYMGETKRFAPEEIS
SMVLTKMRETAEAYLGYKINDAVITVPAYFNDSQRTATKDAGKIAGLNVLRIINEPTAAA
LAYGLDKKLRGEQNVLIFDLGGGTFDVSILTIDEGIFEVRSTAGDTHLGGEDFDNRLVTH
LVEEFKRKNKKDIRSNPRALRRLRTAAERAKRTLSSSTQASIEVDSLYEGIDFYTSVTRA
RFEELCSDQFRKSLEPVERAIVDAKLDKNQIDTVVLVGGSTRIPKIQKLLQDYLNGKELN
KSINPDEAVAYGAAVQAAILSGDQSSEVKDVLLVDVAPLSLGIETAGGVMNKLIERNTRI
PTKAQQTFTTYADNQSAVSIQVYEGERSMTKDNNLLGNFELSGIPPAPRGVPKIEITYDI
DANGILNVTAKDESTGRTNKITISNDKGRLSKADIDRMVNDADKYKAEDEAQFARVSARN
QLESYAFGMKSTVNDSALESKLSAEDKQTILKAVEDTIQWLESNSLADKDEFKFKTDELQ
KKCSPIMAKLHQGSGGGSGQQQPAGGPRVEEVD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacccgacagcgatcggtattgatctagggaccacgtactcgtgtgtgggcgtc
ttccagaacggcagggtagagatcatcgcaaatgaccagggtaacaggaccacgcctagt
tatgtagcattcacggatacagagagattgatcggagatgcggcaaagaaccaagttgct
atgaatcctcgaaacacaattttcgacgcgaagcgtctgatagggcgtcggtttgatgat
acggctgtgcagtctgacatgaaacactggtcatttacggtcaccaacaacggcggcaaa
cccatgttacaggcggagtacatgggcgagaccaagcgctttgctccagaagaaatcagt
tctatggtcctcacaaaaatgcgtgaaacagctgaagcttacctcggttacaagatcaac
gacgcggttataaccgtcccggcttactttaacgactcgcagcgcaccgcgaccaaagac
gcgggtaagatcgctgggttaaacgtcttgcgtattatcaacgagcccaccgcggccgct
ctagcgtacggcttggataagaagctccgcggagagcagaacgttctgattttcgaccta
ggcggtggaactttcgatgtttccatcttaaccattgatgagggaatctttgaagtcagg
tcaaccgcaggggatacacatcttggaggagaggacttcgacaaccgattggtgactcat
cttgtggaagagttcaagcggaagaacaagaaggatattcgcagcaatccccgtgctttg
aggcggttgcgtaccgctgcggaacgtgcaaagcgtacactttccagtagtacccaggca
agtattgaggtggattccctctatgaaggcattgatttctacaccagtgtgaccagggcc
aggtttgaagaactctgctcggatcagttcagaaagagtcttgagcccgtcgaacgcgcc
attgtggacgccaaactcgataaaaaccagatcgacaccgtggttctggttggtggctcc
acgcgtatccccaagatccagaaactcctgcaggattacctgaacggaaaggaactgaac
aagtcaatcaatccagacgaggccgttgcctatggtgcggcagtgcaggctgccatcctt
tcaggggatcagagctcagaggtaaaagacgttcttttggtggatgttgccccgttgtct
ctcggaattgagaccgctggcggtgtcatgaacaaactgattgaacgcaacacccgcatc
ccaacaaaagcccaacaaaccttcacaacctacgcagacaaccaaagcgcggtcagcatc
caggtctacgaaggcgaacgctccatgaccaaagacaacaacctcctgggcaacttcgaa
ctgtctggaatccctcctgcacctcgcggtgtcccaaagatcgagatcacctacgacatt
gatgctaatggcatcctaaacgtcacagccaaggacgagagcactggtcgtaccaacaaa
atcaccatcagcaatgacaagggaaggttgtccaaggcagatattgacaggatggtcaac
gatgcagacaaatacaaagctgaagatgaagcacaattcgctcgcgtttcagctcggaac
caactagagagctacgccttcggcatgaagtctacagtcaacgattctgcgcttgaaagc
aagctgtctgcagaggacaaacagacaatcctcaaggcggtggaagacactatccaatgg
ctggaaagcaactcgttggccgataaggatgagtttaagtttaagacggatgagttgcaa
aagaagtgttcacccatcatggctaagcttcatcagggaagcggaggaggatcaggacag
cagcagccggctggtggaccacgagtcgaagaggtcgattaa

DBGET integrated database retrieval system