KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577326
Entry
577326            CDS       T01019                                 
Name
(RefSeq) cleavage and polyadenylation specificity factor subunit 6 isoform X1
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03015  mRNA surveillance pathway
spu03250  Viral life cycle - HIV-1
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    577326
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    577326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spu03019]
    577326
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     577326
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 577326
NCBI-ProteinID: XP_011673791
Position
Unknown
AA seq 953 aa
MADGVDIDLYADDVDQEFSQEAEQYNSSSGGVDLYDDVITAPSDGGGGKPQNVSGGGDAS
KARRHSSDQHNSNQPSYSGKRVSLYVGNLTWWTTDMDLKQAVNELGVKDLHEIKFFENRA
NGQSKGFAAVHVSSDNSYRLLMHNLGKKEIHGQLPMVTQYNKQNFGQFDQASKKAQDSRE
QRPEGRPNNPGREERFNQHNNNWRGGAQGGQGDGRDNRDNRDNRDNRDNRDFRNRDDRFQ
DRRGGNSFGGPPNNQGPPPPRFQNQGPPQGPPHMNQGPPPMNQGPPPMNQGPPPMNQGPP
PMNQGPPPMNQGPPPMNQGPPMNQGPPMNQGPPMNQGPPPMNQGPPPMNQGPPPMNQGPP
PMNQGPPPPMNQGPPPMNQGPQGPPRQGPHPQGPPPPRGMPPPNQGPPPMQGPPRPGGPP
PRGPPPGMPPPGMQGPPRGPPLPGGPRGPPPPGMRGPPPPNMDKGPPPMGPPGGPPRMQG
PPPPHPGGPPPHHGGPPPPHQGPPQHHGGPPPPHQGPPPRGPPPGPAPRPGGPPPPHMSG
PPLPMPGPGGPPPNRGPPPPMQGPPPPMQGPPPNQNMMQGPPRGPLPPQGVPPPGRPQVS
GPPPNMGPPPNMGPPPMQAPPQNMAPPQMQAPPQNMAPPPQNMQGPPQNMQGPPQNMQGP
PQNMQGPPPNMNRPPLPHNMGGHPPQSMSGPPPNMGAPPLNMGGPPPVAPVPQQHHVQQT
MPQPQQVQAPVSVAPPAPHVNPAFFTGQPQVQQQQPQQAPPQQDRTMYDQSRQQTYTQQE
YRAPSEPDRQPSPAPQLGEAEFEEIMNRNRNVSSSAIARAVNDASSGAFTSAIDTLETAI
SLIKRSKVANDDRCKLLISSLQDCLHGIETKSYGGSSGSSSSRSRKDRGSRERDPENRHR
SRESRSSRHKRERSRSRDREYRERSREREYSDRERGDRHRDRDRDRDREYRRR
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggcggatggcgtggacatcgacttgtacgccgacgatgttgatcaggaatttagccag
gaggcagagcagtacaactcaagctcaggcggtgtggacctctatgatgatgtcataaca
gcaccttcagatggcggtggcggtaagcctcaaaatgtgtctgggggtggcgatgcttct
aaagctcgtcgtcattccagtgatcagcataactccaatcagccgtcctactcgggcaag
agagtctccctctatgttggcaatcttacatggtggaccacggacatggacctgaagcag
gccgtcaatgagctgggtgtgaaggacctgcatgaaatcaagttctttgagaatcgagcc
aatggccaatccaaggggtttgcagctgtacatgtgagctcagacaactcatacaggctc
ctcatgcacaacctaggaaagaaagaaattcatggccagcttccaatggtcactcagtac
aataaacagaactttggccagtttgaccaagcttctaagaaagcacaagatagcagagaa
cagcgtccagaaggcagacctaacaacccaggccgagaagaacgcttcaaccaacataac
aacaactggagaggtggcgcccaaggtggacaaggcgacggtagagacaaccgtgataat
cgtgataatcgtgataatcgcgacaatcgcgatttccgcaaccgcgatgaccgtttccaa
gatagacgtggtggaaactcttttggaggccctcctaacaaccagggcccgcctcctcca
agattccagaaccagggcccacctcaaggaccgccccatatgaatcagggaccacctcct
atgaaccagggaccacctcctatgaaccagggaccgcctcccatgaaccagggaccgcct
cccatgaaccaaggaccgcctcccatgaaccaaggaccacctccaatgaaccaaggacct
cccatgaaccaaggacctccaatgaaccaaggacctccgatgaatcagggaccgcctccg
atgaatcagggaccgcctccgatgaatcaaggaccgcctccaatgaatcaaggaccgcct
ccaatgaatcagggaccgcccccacccatgaatcaaggtcctccacctatgaaccagggt
ccacaaggtcccccacggcaaggaccacatcctcaaggtccaccaccaccccgaggtatg
cctccacccaaccaaggtcctcctccaatgcagggaccgccccgcccagggggacctcca
ccgcgcggccctcctccagggatgcctcctccaggtatgcaaggacctccccgtggccca
ccactaccagggggtcctagaggcccccctccaccaggcatgcgtggaccacctcccccc
aacatggataaaggaccccctcctatgggtccaccaggtggacctccacgcatgcagggc
cctcccccaccccacccaggtggcccgcctccacatcatggtggccctcccccaccccat
caaggcccacctcaacatcatggaggtcctccccctccccatcaaggcccgcccccacgt
ggcccccctcctggacccgctcccagaccaggaggacccccaccacctcacatgagtggt
ccacctctccccatgccaggcccaggtggacctcctccaaacagaggcccgcctcctccc
atgcagggaccaccccctccaatgcaaggaccgcctccaaatcaaaacatgatgcagggg
cctccaagaggacctcttcccccgcaaggggtccctcccccaggccggcctcaagtctct
ggtcctcctccaaacatgggcccgccccccaacatgggaccacctcctatgcaggctccg
ccccaaaacatggcacctcctcaaatgcaggctccaccccaaaacatggcacctccccct
caaaacatgcaaggacctcctcaaaacatgcagggacctcctcaaaacatgcagggacct
cctcaaaacatgcaaggacctcctcctaatatgaacaggcctcctctcccacataacatg
ggcggccatccaccccaaagcatgagtggccctccacccaatatgggggccccgcctcta
aatatgggaggaccgcctcctgtggcacctgtcccccagcagcatcatgtacagcagaca
atgccccagcctcaacaggtgcaagctcctgtttctgtagcgcccccagcgccccatgta
aaccctgccttcttcactggtcagccgcaggtacaacagcagcaaccccagcaagcacct
ccccagcaagacagaacgatgtatgaccagtcaaggcagcagacctatacacagcaagaa
tacagagctccatcagaaccagacaggcaaccctctccggcccctcagttgggcgaggcc
gagtttgaagagatcatgaacaggaatcgtaacgtatcgtctagcgccatcgctagggcc
gtcaacgatgcatcatcaggtgccttcaccagtgctatagacacattggagacggccatc
tcactcatcaaaaggtcaaaggttgctaacgatgaccgttgcaagcttcttattagctct
cttcaggattgcctgcatggaatcgagaccaagtcctacggaggatcatcaggttcaagc
agctcgcggtcacgcaaggaccgaggatcgcgagagcgtgaccctgagaaccgtcacagg
tcacgtgaatctcgcagctccaggcataaacgtgagagatctcgcagtcgggacagagaa
taccgggagaggagcagagagagagagtacagcgacagggagcgtggggatcgtcatcgg
gaccgggatcgggaccgtgatagggagtaccgaagacgttag

DBGET integrated database retrieval system