KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577345
Entry
577345            CDS       T01019                                 

Gene name
Sp-Smad2/3
Definition
(RefSeq) uncharacterized protein LOC577345
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04068  FoxO signaling pathway
spu04144  Endocytosis
spu04310  Wnt signaling pathway
spu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    577345 (Sp-Smad2/3)
   04350 TGF-beta signaling pathway
    577345 (Sp-Smad2/3)
   04068 FoxO signaling pathway
    577345 (Sp-Smad2/3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    577345 (Sp-Smad2/3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 577345
NCBI-ProteinID: NP_001075435
UniProt: A2PZA6
AA seq 427 aa
MSTLSLPFTPPIVKRLLGWKKDNSEDKWSEKAVKSLVKKLKKTGCLEELERAVTTQNSQT
KCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELKAVERCEYAFHLKKDEVCV
NPYHYARVETPVLPPVLVPRITDQPLDIPRTLPHLDDLTHTVPDNATYLVGMDTQSPQTH
TLPPETPPPGYVSDDGETSEQNMDTSSTNGSSTAPQSSESLDLQPVSYCEPPFWCSIAYY
EMNQRVGETFHASQPSLTIDGFTDPSSSERFCLGLLSNVNRDPQVEQTRRHIGKGVRLYY
IGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAAQLSQSVNR
GFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDRVLTQMVPPD
KQCSSVS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcacattaagcttgcctttcacgccaccaattgtgaagaggttgcttggatggaag
aaggacaattcggaagacaaatggtcagagaaagccgtcaaaagtttggttaagaagcta
aagaaaacaggatgccttgaagaacttgaaagagctgtaacgacgcagaacagccaaacc
aaatgcattacaatacctagatcccttgatgggcgtttgcaagtgtctcacagaaagggg
cttccccatgtgatctactgcagactttggcgttggcctgatcttcaaagccaccatgag
ctcaaggctgtcgaacgttgtgaatatgcctttcatctcaagaaggatgaggtctgtgtc
aacccataccactatgcacgagttgagactccagtgcttcctcctgtactggtgcctaga
ataacagaccaaccgctagatatcccaagaacactaccccatcttgatgacctgactcat
acagtacctgataatgctacctatttggttggaatggacacacagagtccgcagactcac
acacttcctccagaaaccccacctccaggctacgtgagtgatgatggtgagacaagtgag
cagaatatggatacatcatcaacaaacggcagtagtacagctccacagtcttcagaatct
cttgatttgcagcctgtgtcatattgtgagcctccattctggtgttctattgcttattat
gagatgaatcaacgagttggtgagacgttccatgcatctcaaccatcactaaccattgat
ggattcactgacccatcaagctctgaaagattctgtcttggtcttctctctaatgtcaat
cgagatcctcaagttgaacagacacgcagacatattggtaaaggtgtaaggttgtactac
ataggtggagaggtatttgctgagtgtttaagtgatagcagtatctttgttcagagtcct
aactgtaatcagagatatggatggcatcctgctacagtctgtaagataccgccaggatgc
aacttgaagattttcaataaccaggagtttgcagcacagctttctcagagtgtgaatcga
ggttttgaggctgtctatcaactgacacggatgtgtaccatccgtatgagctttgtcaaa
ggatggggtgcagagtatcgacgtcagacggtcacctctacaccatgttggattgaactt
catctgaatggacctctgcaatggttggatagagttcttacacagatggttcctcctgat
aaacagtgctccagcgtgtcttaa

DBGET integrated database retrieval system