KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577673Help
Entry
577673            CDS       T01019                                 

Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    577673
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     577673
Chaperones and folding catalysts [BR:spu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   577673
Membrane trafficking [BR:spu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    577673
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   577673
  Exosomal proteins of colorectal cancer cells
   577673
  Exosomal proteins of bladder cancer cells
   577673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_2 Thioredoxin_8 AhpC-TSA OST3_OST6 Calsequestrin
Motif
Other DBs
NCBI-GeneID: 577673
NCBI-ProteinID: XP_011661972
Position
Un
AA seq 590 aa AA seqDB search
MNALLLISLLFGVAYGSDVIDFTDDDFKDNIGDHSLILVEFFAPWCGHCKKLAPEFETAA
TTLQRESPPIALAKVDCTANTQTCGAYGVSGYPTLKVFRNGEPSDYQGPRESAGIISFMK
KQAGPKSVVIATEAQFDDFTSGATAAIVGFFADETSAGLKEFKKLTDAFFEEFRFAYTLD
SGLAEKHSGTDKVVLFRPPQLASKFEESQAVFDGAIKKKDVEKFIRENVHGLCGYMTADN
QAQFTKKPLLTAYYNVDYKLDKKGQCFMSLFPIHRVPLTMHHKPTQKHVVPFLENSETPV
LTQKVDLLWLLLKGPRVVVGKTFDEIVNDETKDVLIEFYAPWCGHCKTLEPKYNELGEAA
CMMPGGRSLPKHRWQVQILVMNVGREFIGSVYLSIASASDFQRKLDDYDTSFDAEGGSPV
VAIEGAKGEKFVMPEKFTVKTLKAFIQAFVNGELEPFIKSEDIPASNDGPVKVVVGKTFD
EIVNDETKDVLIEFYAPWCGHCKTLEPKYNELGEALSGDNNIVIAKMDATANDVPPAFEV
RGFPTLYWAPKNNKSSPKKYEGGREVPDFIKFIKKEATSKPVNTGDKTEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttctgcttatttcgctcctctttggagttgcttacggtagtgatgttata
gattttacagatgatgacttcaaagacaacattggagaccattcactgatattagtggag
ttttttgctccgtggtgcggccattgtaagaaattggctccagagttcgagaccgctgcc
accaccctccagagggagagtcctccaattgccttggctaaggttgactgcacagccaac
acccaaacatgtggtgcctatggtgtatccggctaccctaccctcaaagtattccgcaat
ggagaaccctcagattaccaaggtcccagggaatctgctggtatcatttccttcatgaag
aagcaggctggacccaagtctgtcgtcatcgcgacggaagcacaatttgacgactttacc
tccggtgccactgctgccatcgttggattctttgccgatgaaacaagcgctggattgaag
gaattcaagaaacttaccgatgctttctttgaggaattcagatttgcttacacccttgat
tctggtctggctgaaaaacactcaggcacagataaagtggttctcttcagaccgccacaa
ctcgcgagtaaatttgaagagagtcaagcggtgttcgatggagccatcaaaaagaaggat
gttgagaaattcatcagagaaaatgtccatggactttgtggttacatgacagcagataat
caagcacagttcaccaagaagccactcctgactgcctattacaatgtcgactataaactg
gacaagaaaggtcagtgttttatgtcactctttccaatccacagagtacctttgaccatg
caccacaaacccacacaaaaacatgtagtacccttcctagaaaactcagaaacaccagtt
ttgacgcagaaggtggatctcctgtggttgctattgaaggggccaagggtggttgttggc
aaaacctttgatgagatagtaaacgatgagactaaagacgtcctcattgaattctatgca
ccttggtgtggccattgtaagaccttggagcctaaatacaatgaattgggagaagcggct
tgcatgatgcctggtggtagatcgctgcccaagcatagatggcaggttcaaatcctagta
atgaacgttggtcgggaattcatcggttcggtctacctgtccatcgcctctgctagtgac
ttccaacgaaagctggacgactacgacaccagttttgacgcagaaggtggatctcctgtg
gttgctattgaaggggccaagggcgagaagtttgtcatgccagagaaattcacagttaaa
acacttaaagcattcatccaggcttttgtaaatggtgagctagagccttttatcaagagc
gaagatataccagcgtccaatgatggcccagtcaaggtggttgttggcaaaacctttgat
gagatagtaaacgatgagactaaagacgtcctcattgaattctatgcaccttggtgtggc
cattgtaagaccttggagcctaaatacaatgaattgggagaagcgctcagtggagataat
aacattgtcatagccaagatggacgctaccgccaatgatgtacccccagcatttgaggtc
agagggttcccaaccctttattgggcaccaaagaacaacaaatccagtcccaagaagtac
gagggtggtcgagaggtccccgattttatcaagttcatcaaaaaagaagccacaagtaaa
ccagtcaacaccggagacaagaccgagttgtaa

DBGET integrated database retrieval system