KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577808Help
Entry
577808            CDS       T01019                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase-like
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00520  Amino sugar and nucleotide sugar metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    577808
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     577808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 577808
NCBI-ProteinID: XP_030836998
Position
Unknown
AA seq 413 aa AA seqDB search
MLKMPSNGLVSHHPIIQFRNCRILHQRRIIRDDLWVRNGEILNPRKLFWEEKGYADHQID
CQNAIIVPGYIDVQINGGFGYDFSSEPELVSEGIQKVAQGILSHGVTSFCPTLITSSPDT
YRKIIPQIHKTEGSNKGAGVLGLHLEGPFISVEKRGAHPQHLVHPLSGGTQDLFDVYSNL
DDVAIVTLAPELINAKAAVQELVKRGITVSVGHSTANLCIAEESVNAGASFITHLFNAML
PFHHRDPGIVGLLASNAINRCVYYGVIADGIHTHPAALRIAFQTHPDGVVLVTDALSALG
LPPGRHQLGTQQLDVRDNAAYVAGTNTLSGSIATMSSCVKFLQGATRCTTVEAVEAATLH
PAQLLGITERKGTLDYGTDADFLFVDEDLNVKRTYIAGEMVWDSKTGFRNKSS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatgccttccaatggcttggtttctcatcatccgatcatccagttcaggaac
tgtcgcatcctccatcagcgtcggatcatccgagacgacctgtgggtgagaaatggggag
atcctgaatccaagaaagcttttctgggaggagaaaggctatgctgatcaccagatagat
tgccagaatgccatcattgttcctggctacattgatgtgcaaatcaatggtggtttcggt
tatgacttttcctctgagccagagcttgtgtcggagggaatccagaaggtcgctcaaggc
atcctgtctcatggggtcacctctttctgccccacccttatcacttcatccccagataca
tacagaaagattataccacagatacacaaaacagaggggtcaaacaaaggggctggtgta
ttaggtctacatttagaagggcccttcatcagcgtagagaaaagaggggcacatccccag
cacctggtccaccccctctctggcggcacacaggacctctttgatgtctacagtaatctg
gatgatgtcgccatagtaacgctagctccggagctgattaacgccaaggccgcggtgcag
gagctagtaaagagaggcattactgtgtcagtaggtcattctacggctaatctatgtata
gcagaagagtctgtcaatgctggtgcttcattcatcactcatctcttcaatgcaatgctt
ccattccatcacagagatccaggtatagtgggtcttctggcaagcaatgcgatcaaccgt
tgtgtgtactacggagtgattgccgatggtatccatactcacccagcagctctgcgtata
gccttccagacacatcccgatggggttgtcttagtaacggatgccctgtctgcgctggga
ttaccacctggcaggcatcaacttggcacacaacagctggatgttagggacaatgctgct
tacgtggctggtaccaacactctcagtggaagcatcgccaccatgtcatcttgtgtcaag
ttcttacaaggagcaacccgttgcaccaccgtagaggctgtcgaagctgcaactcttcac
cctgcccagctcctaggaatcacagagagaaaaggaactctagactatggcactgatgcg
gatttcttatttgtagatgaggatttaaatgttaaaaggacttatatcgctggtgaaatg
gtctgggactccaaaacaggtttcaggaataaatcaagctag

DBGET integrated database retrieval system