KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578044
Entry
578044            CDS       T01019                                 
Name
(RefSeq) RYamide receptor-like
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 578044
NCBI-ProteinID: XP_783326
UniProt: A0A7M7RAL6
Position
Unknown
AA seq 393 aa
MESIIVILNSSVPADNYSVISGSNYSEIRELYKEPPWIQALYGVIFALVTVLGVGGNSIV
CYIVLGNRRMRTVTNYSIVNLAVSDILMAVMCVNFSFYAAMYMTWPFGEFMCKAVSYIQS
VSVSVSIFTLVSIGVDRYIAICHPLVLRMGSSQALTVIAVIWVVACVVALPSLIFSTVGV
EGDSTFCSESHWEQSKIYTYILMGIQYFVPLCVLAVTYGRIGYVIWSRRTPGETQASRDK
KINESKTKLVKMFAMVVLLFALCYLPIHFFNILQEVYENVLYYRYIKLVYLTVLLAAMSN
CVYSPFIYCWMNAKFRNGFKSAFRFLPGVHYDNQWKVVAHLERGNTAMTQLTTSPSRRLR
GGPSDAKHCWPEHSYESLSNGNGSPMRDKMVAV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagtctattattgtgatattgaattcatcggtaccggctgataactactcagtaata
tctggaagtaactactcagaaatacgggaactgtacaaagaacctccatggatacaagcc
ctctatggtgtaatctttgcccttgtgactgtgttaggcgttggtgggaactctatcgtc
tgctacattgtgcttggaaaccggcgcatgcgcaccgtcacaaactactccatcgtgaat
ttagcggtaagcgatatcctcatggcggtcatgtgtgtcaatttttcattttacgccgca
atgtatatgacgtggcccttcggggagttcatgtgtaaagcggtatcgtacatccaaagc
gtgtctgtgtctgtgagtatctttacgctggtgtccatcggtgtggaccgttacatagcg
atatgccatcctctagttctacgtatgggatcatcacaagcattgacagtcatcgcggtt
atctgggtagtcgcgtgcgtagtagcgctaccttctttaatattttccacggtcggcgta
gagggggactcaacattttgctctgagagccactgggaacaatctaaaatttacacgtat
atcctgatgggtatccaatattttgtaccactttgtgtattggctgttacctatggtagg
attggttatgtaatctggagtagacgaacacccggagaaacacaagctagcagagacaag
aagatcaacgagtcaaaaacaaagctcgtcaagatgttcgctatggtcgttcttctcttc
gccttgtgctatctaccaatccacttcttcaacatcctccaggaggtctacgagaatgtc
ctctactaccgctacatcaagctggtctacctcactgtactcctggcagccatgagcaac
tgtgtctacagcccttttatttactgctggatgaacgccaagttccgcaacggcttcaag
tctgcgttccgattcctccccggcgtgcactacgacaaccaatggaaagtggttgcgcat
ttagaacgtggcaacaccgccatgacgcaactgacgacgtcgccgtcgcgtcggcttcgt
ggtggtccatcggatgcgaaacattgctggcccgagcatagctacgagtcgcttagcaac
gggaacgggagtcctatgagggacaaaatggttgccgtgtga

DBGET integrated database retrieval system