KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578600Help
Entry
578600            CDS       T01019                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spu01001]
    578600
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    578600
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     578600
Protein kinases [BR:spu01001]
 Serine/threonine kinases: Other
  Wnk family
   578600
Protein phosphatases and associated proteins [BR:spu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     578600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C DUF3876
Motif
Other DBs
NCBI-GeneID: 578600
NCBI-ProteinID: XP_011682144
Position
Unknown
AA seq 572 aa AA seqDB search
MSKSESHNSGSSLSNGVASLEERDTDVPLKSHSSESVTKQGSKGKSGDTQTEEAEAADAS
HSGVNGESSMGNSVVISNRRSPNFSDTDVNVESFHNDKVTENSESAADTKHTVISDESST
TGYSSRLDSIGDKELLKEKVPDTSVHLANSHPNGTALKSARKDSNMKPERGRIASGNGKK
QKSVVIMAPVKDITENGHIEVHKEEKVEPLQIHEMHDSERRLLIETEEAEPEAVEEKAIA
KSADGRFMKYDVAVGQGSFKTVFRGLDTETGVAVAWCELQERKLSRSERQRFKEEAEMLK
GLSHPNIVSFYDYWEEVSPRGKKHIVLVTELMTSGTLKTYLKRFKGVKNRVLRSWCRQIL
KGLHFLHTRQPPIIHRDLKCDNIFITGTSGAVKIGDLGLATLKKSSFAKSVIGTPEFMAP
EMYEEHYDEAVDVYAFGMCLLEMATSEYPYAECSNAAQIYRRVTTGVKPQSFEKVNDNKI
KEIIDGCTKTNNTERYLIQELLKHTFFEDTAFRVDIVHDDNKDQIQLQLRVEDPKKRRER
HRDNEALQFEIDLNKDEPDQVAKEMVIKFLFS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcagagagccacaacagcggcagctcgctgtcaaacggagttgcgtcgttg
gaggaaagagacacggacgtcccactaaagagtcatagcagtgagagtgtgactaagcaa
ggcagcaaaggcaagtctggtgacacacagacagaggaggcagaagctgccgatgcgagt
cactcgggtgtaaatggcgagtccagtatgggaaacagcgtcgtgatttctaatcgcaga
tctcctaacttttctgatactgatgtgaatgttgagtccttccacaacgacaaggttaca
gaaaactctgaaagtgcagctgatacaaaacacacagtaatcagtgatgaaagtagcacc
actggatatagcagtagattagatagcatcggtgataaagaactattaaaagaaaaagtg
cctgatacatctgttcacttagcaaattcacatccaaatggaactgctctgaagagcgcc
agaaaagacagtaatatgaagccagaaaggggtagaatagcttccggaaatggaaagaaa
caaaagtcagttgtaattatggctcctgtaaaggatatcactgaaaatggtcacatagag
gtacacaaagaagagaaggttgagcctttacagatacatgaaatgcatgattctgaaaga
cgtctcctaatagaaactgaggaagcagaaccagaagcagtggaagaaaaagccattgct
aagtctgctgatggccgcttcatgaagtatgatgtagcagtaggacaaggttccttcaag
actgtgttcagagggttggatacagagactggagttgcagtggcatggtgtgaattgcag
gagcgcaagctgagtcgttctgagcggcagagattcaaagaagaggccgagatgctgaag
ggactcagtcatccaaatattgttagcttctatgactactgggaagaagtcagccccaga
ggaaagaaacatatagtacttgtcaccgaacttatgacatctggaaccttgaaaacatat
ctcaaacgcttcaagggcgtgaagaaccgtgtgctgcgaagctggtgccgtcagatcctg
aagggcctgcacttcctccatacaagacaacctcccatcatacaccgtgatctcaaatgt
gacaacatcttcatcacaggcacttctggtgctgtcaagattggtgatctgggtctggcc
accctcaaaaagagctcctttgccaaaagtgtaataggtacacccgagtttatggctccg
gagatgtacgaggagcactatgacgaggctgtcgatgtgtatgcgtttggcatgtgcttg
ctggagatggccacatccgagtatccgtacgcagagtgctccaatgctgcacagatctac
cgaagagttaccacgggagtgaaaccacaaagctttgaaaaagtcaatgacaacaagatc
aaagaaatcattgatggctgcaccaaaacaaacaacacagagaggtatcttatccaggag
cttctgaagcacacattctttgaggatactgctttccgcgtggacatcgtccatgatgac
aacaaagatcagatacagctccagctgcgtgtggaagaccccaagaagagaagagagagg
cacagagacaatgaagctctccagtttgagattgatttgaataaagatgaacctgaccaa
gttgctaaagaaatggtaattaaattcctcttttcataa

DBGET integrated database retrieval system