KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579182
Entry
579182            CDS       T01019                                 

Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spu03021]
    579182
Transcription machinery [BR:spu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     579182
SSDB
Motif
Pfam: AF-4_C
Other DBs
NCBI-GeneID: 579182
NCBI-ProteinID: XP_030836427
Position
Unknown
AA seq 917 aa
MKRSDIESSGSESDAENTSESESESEESDIDETPPPSPPPPKKKSYSLMNQIRKVQKEMP
QMAPSTPPIRGPPSVENPLSNSRLDPNEGSKHPEQSAESGDDNDNFSKYNNSQPPTFTDF
HQLSESSHESKASPSSVKSKGGSKSSTKPLGSSKPTVKRPQSRTDNSSSSKASSAKDTSS
SPRVKPESNSKESTKAKSSKQSSKSASSGQNKKSPGPGAGAKSSSKSQEKKPGQRAKTSE
KKKNIKPIIKSNQFVSDSDSEDERTPLRPSSKAAINTSTSSSGSSSSSNLDTSYPVRQTK
VEPDSGKRMPGVKKGDNKYIVKPEPLDTYEHRRPPFDDFAHMDPIVSPIRADFIDEQSRP
LDRHPEIKFDKDGKPSVFVRLKRELFDHLPKSSVIKFEQNVPGTSTQKRKDSNDPPEKPS
AIVKPVKRKQTELEKEKSGRPENKRSRIENKSPRRMREEALRGVRDEPTEALEPFVSSES
SLDRRQSSDRRGSVSSMTSQQSSHSSRRTKNDCDPHHPSSRSKRDSSRSRDFASQRLHDW
TSPERHADRSVEMPHNVALGGGEADPAASSHRNGGLSHSHSHSLPPHAHHSTASHPHRGV
EGEDWRVFPPAESYQGYGEEAQSRHRLELDERQFTADDYLAEGKKLKHLADTQVDKHAKA
LTYFEAVVYLTSCGNVFELDPLVPDDKAVTMYSDTCEIIRYILKLKGIHNGQEGNSNDNK
LAVLCYRCQALLNMHMFKLKRQSAMNLSRALTEHLKGTSSKPQPPLQQNPSSWNSSSRYT
GTPSPVSPTPSAAGSVGSACSMGSQGSTSSDLVPSQTSGGGPAPPSGPGAKLCNGLNPQS
STVAMPQHIVRIMSQFLTYSNYSLYSIQYWEQADILTEENKDFFRDLARECGELTLHSST
RDLVHYVRRGLTNLRRL
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgaagcggtcagacatcgagagctccggcagcgagtcggacgcggagaacacgtcggag
agcgagagtgagagcgaagagagtgatattgatgagactccacctccatctcctcctcct
cctaagaagaagtcatacagcttgatgaaccagatccggaaggtgcagaaagagatgccc
cagatggcaccaagtactcctccaatccgtggaccacccagcgtagagaacccactctcc
aattccaggctagatccaaacgaagggtccaagcacccagaacagagcgcagaaagcggg
gacgacaacgataacttcagtaaatataacaacagccagcctcccaccttcacagatttc
catcaactctcagaaagctcgcacgaatccaaagcatctccaagctctgtcaaatcaaaa
ggaggtagcaaatcatcgacgaagccgttgggcagtagtaaaccgactgtaaagcgccct
cagtcacggacagacaactcaagtagctccaaagcgagcagtgcgaaagacactagcagt
tcacccagagttaaacctgaatcaaattctaaagagagcaccaaggctaagagtagtaaa
cagtccagtaaaagtgctagtagtggtcagaacaaaaagtcccctggacctggggctgga
gcaaagtccagcagcaaatcccaggagaagaaacctggacagagggccaagacaagcgag
aagaagaaaaatatcaagccaattatcaagtcaaatcaatttgtttcggactctgattcc
gaggatgaaaggactccattgcggccgtcgtccaaggcggccatcaacactagcacgagt
agtagcgggagcagtagctccagtaacttggacaccagttaccctgtcaggcaaaccaag
gttgaaccagacagcggcaagcgcatgccaggtgtaaaaaagggcgataataaatatatt
gtgaaaccagagcccctggatacctatgaacatcggagaccaccttttgatgactttgct
cacatggaccctattgtttccccgataagggcagacttcattgatgagcagtcgcgtcct
cttgaccgccatccggaaatcaagtttgacaaggatggcaaaccgtcggtgtttgtcagg
ttaaagcgggagctctttgatcacttgccaaagtctagtgtgatcaagtttgaacaaaac
gttcctggaacttcaactcagaagcggaaagactccaacgacccgcctgaaaaaccctcc
gcaatcgtaaagcctgtcaaaaggaaacaaactgaacttgaaaaggagaaatctgggagg
ccggagaacaaaagatcaagaatagagaacaagtcaccgaggaggatgagagaagaagct
ctgaggggtgtgagggacgagcccaccgaggccctagagccgtttgtatcgagtgagagt
tcactagacaggcggcagtcttcagacaggagagggagtgtgtcaagtatgaccagtcaa
caatcctcacacagtagcaggagaaccaagaacgattgcgacccccaccatccatccagc
cgctccaagcgggacagcagccgcagccgagactttgccagccagcgcctccacgactgg
accagccccgagcgccatgctgataggtcagtggaaatgccgcacaatgtggccctcgga
gggggcgaggccgacccagccgcctcctcacaccgcaacggcggcctctcccactctcat
tctcactctctccctccccacgcccaccattccaccgcttctcacccccataggggtgtg
gaaggggaggactggagggtgttccctcctgcagagagctaccaaggttatggtgaggag
gcgcaatccaggcacagactagagttggacgaaagacaattcacagcagacgactaccta
gctgagggcaagaaactcaaacacttagctgatactcaggtggacaagcacgccaaggca
cttacttactttgaagctgtggtatatctcacatcctgtggcaatgtctttgagttggac
ccgctcgtaccggatgacaaagctgtcaccatgtattcagatacttgtgaaattatcaga
tatattctaaagcttaaaggtattcacaatggccaggaggggaatagcaatgataacaaa
ctagccgtgttgtgctaccgttgccaagcgttgctcaacatgcacatgttcaagctgaag
cgacaatcagcgatgaatctatcgagggcgctaactgagcatctcaagggcacatcatcc
aaacctcaacctccgttacagcagaatccatcttcatggaactcgtcttcaaggtacaca
ggcaccccgtcccccgtctctcccaccccttccgcagcgggcagcgtgggctcggcctgc
agcatgggttcgcaggggagcacgtccagcgatctggtcccctcccagacttcagggggc
ggcccagcccctccctccggccccggggccaaactgtgcaatgggctgaacccgcagtct
tcgacggtagccatgccgcaacacatcgtccgtatcatgtcccagttcctcacctattcc
aactacagtctctacagcatacaatactgggagcaggctgatatactcacagaagagaac
aaagatttcttccgggatttggcgcgagagtgcggggagcttacacttcacagcagtact
cgggacttggtccactacgtccgtagagggctaactaacctcagacgcttgtga

DBGET integrated database retrieval system