KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580919Help
Entry
580919            CDS       T01019                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04068  FoxO signaling pathway
spu04137  Mitophagy - animal
spu04140  Autophagy - animal
spu04141  Protein processing in endoplasmic reticulum
spu04310  Wnt signaling pathway
spu04933  AGE-RAGE signaling pathway in diabetic complications
Module
spu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    580919
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    580919
   04068 FoxO signaling pathway
    580919
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    580919
   04137 Mitophagy - animal
    580919
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    580919
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     580919
Protein kinases [BR:spu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   580919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 580919
NCBI-ProteinID: XP_011677391
Position
Un
AA seq 417 aa AA seqDB search
MAGTKLNHHQPNHHQFNYHQLNSQFYHVTVGDTHFQILKRYKNLKSVGSGAQGLVVAAYD
VLTNQSVAIKKLSRPFQNVTHAKRAYREYILMKLCNHKNIIGLLNVFTPQRTFDDFADIY
LVMELMDASLVQVVQMDLDHERISYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKTDCSL
KILDFGLARTASTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSIGCIFGEMIRGQVMF
PGSDHIDQWNKIADLLGTPTDIFLSRLQPMVKQYVENRTKCPGYSFEMLFPDELFYQAES
STEKTKLCVAQARNLLSKMLIVDPEQRISVDEALQHPYINVWFDPGEVYGPPPIPYDHSI
DDGGDHILEEWKDGTSHPIEEEKDEREHTLEQWKGKLHYSYSESLSYPHYPLNVSKF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccaagctcaaccaccatcagcctaaccatcatcagttcaactatcatcaa
ctcaactcacagttctaccatgtcactgttggagatacacatttccagatcctcaagaga
tacaagaacctcaagagtgttggcagcggcgcccaaggtctagtcgtagctgcatatgat
gtcctcacaaaccagagtgttgctatcaagaagctaagtcgaccgttccagaatgtgacg
catgccaagcgagcgtacagagagtatatcctcatgaaattgtgcaatcataaaaatatt
attggtctcctgaatgtgttcacgccgcagcggacgtttgatgactttgcagatatttac
ctagtgatggaactaatggacgctagtctggtccaagtcgttcagatggacctggaccat
gagaggatctcctaccttctctatcagatgctatgtggcatcaaacacttacacagtgca
gggattatccacagagacttgaaacccagcaatatcgtagtaaagacagactgttcgctg
aagatcctggactttggtctcgccaggacagctagtactagcttcatgatgaccccttac
gtcgttaccaggtactacagagcaccagaggtcatcctaggcatgggctacaaggagaac
gttgatatctggtccataggctgtatatttggtgagatgatcagaggacaagtgatgttc
cccggctcagatcacattgaccaatggaacaagatcgctgacctcctagggaccccaacg
gacattttcctgagcagactccaacccatggtcaagcagtacgttgagaacaggacaaag
tgtccgggctattcctttgagatgttgttccctgatgaactcttctaccaagctgagagc
agtacggagaagaccaaactgtgtgttgcacaagccagaaatctgctctcaaaaatgctc
atcgtggaccccgaacagaggatatcagttgatgaagctcttcagcacccctacatcaac
gtatggtttgacccaggagaagtgtatggacctcctccaattccttatgaccattcaata
gacgacggcggtgatcatatattagaagaatggaaagacgggacttcacaccctatagaa
gaggagaaagacgagagggagcacacattggaacagtggaaaggtaagcttcattattca
tattcggaatcattgtcttatccacattatcccttgaatgtttcaaagttttaa

DBGET integrated database retrieval system