KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581911
Entry
581911            CDS       T01019                                 
Name
(RefSeq) 4-coumarate--CoA ligase 1 isoform X1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 581911
NCBI-ProteinID: XP_030838547
Position
Unknown
AA seq 529 aa
MATLKSDYDDVIIPEDVSAMDFIYEKFEQFGDSTAVADAASGRSYTFAQVRAYSRRIASA
LSRQGIKKGDVIGIVSPNLPEYVLMLCGVVEMGGIVSGVNPLYTEDELLHQMETVDARLI
VTVPPFAEKCLNTMKRFPRVQDVYVFGEAEGCKPFKSLLADDGSACPHVKVSLEDTFALP
FSSGTTGLPKGVILTNKTIVSNLRQLESHPDLTDTRPGDTVLALLPYFHCYGLVVIMLHG
LRKGARQVTMSRFEPEVFLKTIQDYKVNHLYLVPPIMLFLAKHPVVDKFDLSSVSLIISG
AAPLGGELTASLKTRLGIKVIKQGYGLTESGPVLTLSPSSTDVPSSVGKLLPNTEAKVVD
TVSGELLGEGQDGELLFRGPQIMPGYLNNPEATARTLDADGFLHTGDIGHYDQDGLFYIV
DRLKELIKYKGYQVAPAELETLLLTHPSIMDAAVIGVPNEEAGELPKAFIVPKNQELTAD
QVAEFVADNAAPYKKLRGGVEFVKSIPKSASGKILRRVLREKEANPEQA
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggcaaccctcaaaagtgattatgatgacgtcatcatccctgaggatgtttctgcgatg
gatttcatttatgaaaagtttgagcaatttggagactcaactgcagtggcagacgctgct
tcaggacgatcgtacaccttcgctcaggtgagagcctattccagacggattgctagcgcc
ctctctaggcaaggaataaagaagggggatgtcataggcattgtgagccccaatctcccg
gagtacgtgctgatgctatgtggggtagttgagatgggcggtatagtgagtggtgtcaac
cccctgtacactgaagatgagctgctgcatcaaatggagactgttgatgcaaggcttatc
gtaaccgtgccaccatttgccgagaaatgtcttaacaccatgaaacgattccccagagtt
caggatgtttatgtgtttggggaagcagaaggctgcaaacccttcaagtctctcctggct
gatgatggtagcgcttgccctcatgtgaaagtctctctagaggacaccttcgccttgcct
ttctccagtggaaccacaggcttgccgaagggggtcattctcaccaacaaaactatcgtc
tccaatctacgccagcttgaaagtcatcctgatctaacggatacacgtccaggggacacc
gttcttgccttgctgccatacttccactgctacggtttggtagtcatcatgcttcatggg
ctacgtaaaggggccagacaggtcaccatgtcacgatttgagccggaagtcttcctaaaa
accatccaagattataaggtcaatcatctgtacctcgttcctcccatcatgctgttcctg
gccaaacacccagtggttgacaagtttgacctttcatccgtcagtctgatcatatccggg
gccgctcctctagggggcgaactaacagccagtctgaaaacaagactagggatcaaagtc
atcaaacaaggttatggtttgacagaatctggacctgttttgaccctctccccgtcctct
acggacgttccgtctagcgttggaaagctcctaccaaacacagaggcaaaggttgtggat
accgtgtcaggagaattgcttggagagggtcaggatggtgagctcttgttcagaggacct
cagatcatgccaggttacctcaacaatcctgaggcaacagcaaggaccctcgacgcagac
ggattcctgcatacaggggacataggccactatgaccaagacggtctcttctatatcgtg
gataggctcaaagaacttatcaagtacaaaggttatcaggttgctcctgctgagctggag
actcttctcctcacccatccctccatcatggatgctgctgtgatcggagttccaaacgag
gaggcgggggagctgcctaaagctttcattgtgccaaagaaccaagaactgacagcggat
caggtagcagagtttgtggcagacaatgcagccccctacaagaaactaaggggtggagtg
gagtttgtgaagtccatccctaagtcagcttcggggaagattttgagaagagtcctccga
gaaaaagaggccaatcctgagcaggcctaa

DBGET integrated database retrieval system