KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582837Help
Entry
582837            CDS       T01019                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00230  Purine metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    582837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spu01001]
    582837
Enzymes [BR:spu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     582837
Protein kinases [BR:spu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   582837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase Pkinase_Tyr HNOBA Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 582837
NCBI-ProteinID: XP_030853875
Position
Unknown
AA seq 1030 aa AA seqDB search
MTAILLALLLTGPPHNLNEIHLRPAIDIAFEKVNNGAARGLYLNFSMSYVFRETGPDCGR
PVMEAPAVAAELYRRYSLDGILGSPCSYETVGIADLAAYWNLPVVTGVSTSAVLDDKSRY
RTLTRTSFKTGVLAKAVVAFFEEYEWRQFALVWQYPGYSSLIAIAMKELMETQENVTMYE
FDLRDYGSIKDALDAAAAVSRSSLFTMINALLFSLTAVIILSAQGELVREAMLHAFDTGL
VDGEYAFVSIEPFSNTLVFGDDNWKQNDGRDDDAKKAYESLLIFRLFKPQTDEYRAFQRE
LERREILDYNWTRPDPDHNNYFASAFHDAVILYSLAVNETLAEGGNISDGYVITRKMWGR
SFKGISGTVTINENGDRSGDYSLWDMTNTEDGTFEVLANYYGETGVIETTGVKPVWPGGG
IGPPRDAPECGFENELCQSNELPILGLVGIVAVVVVLAAAGILFVIYRKHRLDAELMSMS
WKVAWEELIFEEIGKSVATATSGSRALSSKRSMNEEIQDGGQIFATVARYKGRMVMVKKI
GQSKIDLNRRVLMELRNMRNLEHTNVVRFVGACVDPPDQAILTEYCPRGSLQDILENDQL
KLDWMFRQSLLMDAVRGLNYIHDSVIGVHGRLTSSNCVVDGRFVLKITDFGIPSFRNSNK
YEDNNYKLLWRAPERLRDPSSLPSKEGDLYALGIIMLEIGTRCGPFDEERKVMDTDGILE
TLKSTSSQPPFRPSVPEAAWNPVIKDLMKRCWAENPGDRPTASALQTALKKINKGTSSGG
NILDNLLNRMEQYATNLESLVEERTAAFLEEKKRSETLLYEVLPRSVAEQLKQGKSVDPE
SYENVTIFFSDIVGFTSLSSQSTPLEVVALLNDLYTCFDSIIANFDVYKVETIGDAYMVV
SGLPIRNGFAHAREIAQMSLALLGAVTSFKIRHRPDEQLKLRAGIHSGPCVAGVIGVKMP
RYCLFGDTVNTTSRMESTGEALKIHTSLTCKTILDKFQIFVLELRGLVEMKGKGQQTTFW
LLSQKDNDKG
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgattctactagcccttcttctcactggccctccacacaatctcaatgaaatc
catttgcgccccgccatcgacatcgccttcgagaaggtgaacaacggggcggcgcgaggt
ctctacctcaacttctcgatgtcttacgtctttcgcgagacaggaccggattgtggacgg
ccggtcatggaggctccagcggtcgccgccgagctctaccgtcgctactcgctggacggc
atcctcggctcgccgtgcagctacgaaactgtgggaatcgccgacctcgccgcctattgg
aacctccccgtcgtgactggcgtctcgacatcggccgtcctcgacgacaaaagccgatat
cgaaccctcactcgcacgtctttcaaaactggagtgcttgcgaaagctgtcgtggcgttt
ttcgaggaatacgaatggcgtcaattcgcgttggtctggcagtatccgggctactcgtcc
ctcattgcaatcgccatgaaagaattgatggagacccaagaaaacgtcaccatgtacgaa
ttcgatctcagagattatgggtcgataaaagatgcattagacgctgccgcagctgtgtca
agaagctctctattcacaatgattaatgcccttcttttttctttgactgcagtcatcatc
ctatcggcccagggtgaactggttcgtgaggccatgctacacgctttcgacaccggactc
gttgacggcgaatacgccttcgtcagcatcgagccgttcagcaacactctggtgtttgga
gatgataactggaaacaaaatgacggtcgggatgatgacgcgaagaaggcctacgaatcc
ctactaatatttcgtctcttcaaaccgcaaactgatgaatacagagcgttccaaagggag
cttgaacgacgagagatcctggactacaactggacaagacctgatccggaccataataat
tactttgcgagtgcttttcatgatgctgtgattctgtacagcttggcggtgaatgagact
ctagctgaaggagggaacatctcggatggttatgtaatcactaggaagatgtggggtaga
tcattcaaaggtatatctggtacagtaacgatcaacgaaaacggtgaccgcagtggagac
tactcactttgggatatgaccaatactgaagatggcacatttgaggtccttgcgaactat
tacggagagacaggtgtgattgagacgacaggggtgaagccagtttggccgggagggggg
atcggaccgcccagagatgcccctgaatgtggatttgaaaacgagttatgccaatctaat
gagctccctattcttggtctggttggcatcgtagctgtggtggtggtcttggcagcggcg
ggcattctcttcgttatttacaggaaacatcgccttgatgcagagctcatgagcatgtca
tggaaggttgcttgggaggagctcatcttcgaggagattggtaaatcggtcgccacggca
acatctggttccagggcattgtcttcaaagagatccatgaatgaagagatccaagatggc
ggccaaatatttgccactgttgccaggtacaaaggtcgcatggtcatggtgaagaaaata
ggccaaagcaaaattgacttaaacagaagagtactcatggaactcagaaatatgagaaat
ctagagcacacgaatgttgtacggttcgttggcgcatgcgtagatccgccagaccaagct
attctgaccgagtactgtcctcgtgggagtcttcaagatatcttggagaatgaccagctg
aagcttgactggatgtttagacaatctttactaatggatgcagttaggggtctcaactac
atccacgacagcgtcatcggagtccatggtcgcttgacatcatctaactgtgtggtcgat
ggccggttcgtcctgaagatcaccgacttcggcataccgtctttccgaaactccaacaaa
tatgaagataacaattacaagctgttgtggcgagcaccagagcgactccgcgacccttcc
agtttaccgtcaaaagagggagacttatacgcactgggtatcatcatgctcgagatcgga
acgcggtgcggaccgttcgatgaggaaagaaaagttatggatacagatggaatccttgag
acactgaagtcgaccagcagccaaccaccgtttcgtccatccgtaccagaagctgcatgg
aaccccgtgatcaaggacctgatgaaacgatgctgggccgagaacccaggtgaccgaccg
acggccagtgccttgcagactgcgctcaagaagatcaacaaaggaacatccagcggtggc
aatattttggacaaccttctgaatcgtatggagcagtacgcaaccaacctggagtccttg
gtcgaagaaaggactgcagccttcctggaagagaagaaacgatcggagacactgctgtat
gaggtgcttcccagatctgtagcagagcagttgaagcaaggaaagtctgtcgaccccgag
tcttacgagaatgttaccattttctttagcgatatcgttggtttcacctccctgtcctct
cagagtacacccctagaggttgttgctctcttaaatgatttgtacacgtgtttcgacagc
attatcgctaatttcgacgtatataaggtcgagactattggagatgcgtacatggtggta
tcgggactaccgataaggaacggctttgcgcatgctcgtgagattgcgcagatgtccctc
gcgcttcttggtgcagtcacatcgttcaagatcaggcatcgccccgatgagcagctcaaa
ctacgagctggtatacattcaggtccttgtgtagctggtgtaataggtgttaagatgcca
aggtactgtttgttcggagacactgtcaacaccacttctcgaatggaatctaccggagaa
gcgctcaagattcacacaagtttgacgtgtaagacgattctagacaagtttcaaatcttc
gtgctcgagcttcgaggactcgtggaaatgaagggcaaagggcagcagactacattttgg
ttgctttctcaaaaggacaacgacaagggatga

DBGET integrated database retrieval system