KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582874Help
Entry
582874            CDS       T01019                                 

Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:spu01002]
    582874
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     582874
Peptidases [BR:spu01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   582874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 582874
NCBI-ProteinID: XP_011670752
Position
Un
AA seq 829 aa AA seqDB search
MYLLSSRFLRVCSTSTLRNVGCSHIKSGHPVQSSSRCRRFWRLRHSACVCSSTTTRYPFG
SILDASSSGLIETSYWPVVRGSSNSIQYRYTGTFPSAVLQCERKMAASQFIIPNEVPIVN
LECKAAFDCLSSKEKKYAHYIGKAAWSGGLICLFQTSPESPLIFLLLQKLFKGQSVEEFK
SAAIEKGTAEDEVQAVLTYAAAFYSNLGNYKSFGDTKFVPNLPQDKFEAVIHASKAYTED
PKSIQTQWHQCKHALYSVEKREQQLGLGEEGITTYFSDNCTQADAELAKKFMFGKDISAY
NTRLMKTVDDKQKVTYEVRLASAKATSEDGDCDIKFGSYEFEGTTFNVTRGDYSPLMAGV
ADNLNRAKDFAANGNESEMMANYVKSFSTGSIEAHKEGSRYWIKDKGPIVETYIGFIESY
RDPFGVRGEWEGFVAMVNKEMSAKFTDLVENAENLLPLLPWPKEYEKDTFLRPDFTSLDV
LSFASSGIPAGINIPNYDDIRQDEGFKNVSLGNVLSAYGKDQTITFLTDTDKELYKKLKG
PSFEVQVGLHELLGHGSGKLFMKDNKGQFNFDTETVKHTETGEKISSWYMPGEVWDSKFP
VIASPYEECRAECVGIYLSLSREALKIFGHEGSAADDILYVNWLNMVRAGILGLEFFTPE
SKTWRQAHMQARFVILRVLVEAGQGLVTITRTTGDDGKPDVIIQIDRTKIETVGKEAIGN
FLRKLQVYKSTGDYTSGRAMFDGYSAVNDDSAEKFLSLRQTVLDRKQPRRMFVQCNTSIG
SDGEVALHEYEASAAGIIQSFVDRYNREDVERNVRDLWEKDQVHFPSVQ
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgttatcatctcgatttttacgtgtgtgtagtactagtacactacgtaacgtt
ggttgttctcacataaaatctggtcatcccgttcaatcatcctctcgttgtcgacgtttc
tggagattaagacacagcgcgtgcgtctgcagctctaccactaccaggtacccttttggt
agcatattagacgccagcagttccggtctgattgaaacctcgtattggcctgtcgtccgt
ggctctagcaatagcatccagtaccgctataccggtacctttccatctgccgttctccag
tgtgaaagaaaaatggcagcttcacagttcatcattccaaatgaagtgcctattgtgaat
ctggaatgcaaggcggcattcgactgtctctcgagcaaggagaaaaaatatgcccactac
attggaaaggcagcgtggagtggaggcttgatttgtctgttccaaaccagcccagaatct
ccactgatttttctgctcttgcaaaaactgttcaaagggcaatcagtagaggagtttaag
tcagctgccattgagaaagggaccgcagaggatgaagtccaggccgtcctgacctatgct
gcagccttctactctaatcttggtaactacaagtcatttggagacacaaagtttgtgcct
aatcttcctcaggataagtttgaagcagttatccatgccagcaaggcttatactgaggat
ccaaagagtatacagacacagtggcatcaatgtaagcatgcattatactccgtagagaaa
agagaacaacaacttggacttggggaggaggggattactacttacttctcggacaactgc
actcaagccgatgcagaacttgcaaagaaattcatgtttggaaaggacatcagcgcctac
aacacacgtctgatgaaaactgttgatgacaaacaaaaggtcacttatgaggtcaggtta
gcctcggcaaaagccacatctgaagatggagactgtgatatcaagtttggatcatatgag
tttgaaggaacaaccttcaatgtgacgaggggggattatagccccctcatggctggtgtc
gcagacaacctcaacagagcaaaggattttgcggccaatggtaatgagagtgagatgatg
gctaactatgtcaagagcttcagcactggatccatagaagcacacaaagaaggctccaga
tactggatcaaagataagggacccattgtagaaacatacattggtttcattgagagttat
cgggatccctttggagtaagaggagaatgggaaggctttgttgccatggtgaacaaggag
atgagtgctaagtttactgacctggtagagaatgccgagaatcttctccctcttttgcca
tggcccaaggaatacgagaaagacacgttcctcagacctgacttcacatccctggatgtc
ttgagttttgcatcgtcaggaataccagcaggcatcaacattccaaactatgatgacatt
cgtcaggatgaaggatttaagaatgtatctctaggcaatgtgctgtctgcttacggtaaa
gatcagacgatcaccttcttgacagatacagacaaggaattgtacaagaagctaaagggc
ccgtcctttgaggtccaggttggtcttcatgagctgctgggtcatggcagtggaaaactc
ttcatgaaagacaacaaaggacagttcaactttgatacagaaactgtgaagcacactgag
acaggggagaagatctcatcatggtacatgccaggagaggtttgggattccaagtttcct
gtgattgcctcaccttatgaagaatgtagagcagagtgtgtaggaatctacctgtctctc
tcaagagaggctctcaagatctttggacatgaaggctctgcagcagatgacatcctgtat
gtcaactggcttaacatggtgagagctggtatccttggtctcgagttcttcacaccagaa
tccaaaacatggcgacaggctcatatgcaggcacgctttgtcatcttgagagtgctggta
gaggcggggcaaggcctagtaaccatcaccaggacaacaggagatgatgggaagcctgat
gtcatcattcaaattgaccggaccaagatcgagacagtaggcaaggaggccattggcaac
ttcctcaggaaactgcaggtgtacaaatccactggagattatacctcgggcagagccatg
tttgatggctactcggcagtcaatgatgactcagcagagaagttcctgtccctacgtcag
acggtccttgatcgcaagcaacccaggcgcatgtttgtgcaatgcaatacgtccattgga
tctgatggtgaggttgccctccacgagtatgaggcatctgcagcaggcatcatccagtct
ttcgttgataggtacaacagagaggatgttgagaggaacgtcagggatctatgggagaaa
gaccaagtacacttcccatctgtacaataa

DBGET integrated database retrieval system