KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583227Help
Entry
583227            CDS       T01019                                 

Gene name
ppp2r1a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03015  mRNA surveillance pathway
spu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    583227 (ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    583227 (ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    583227 (ppp2r1a)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spu03036]
    583227 (ppp2r1a)
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     583227 (ppp2r1a)
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     583227 (ppp2r1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 HEAT_EZ Cnd1 CLASP_N TAF6_C M11L
Motif
Other DBs
NCBI-GeneID: 583227
NCBI-ProteinID: XP_011662449
Position
Un
AA seq 591 aa AA seqDB search
MASKETADDSLYPIAVLIDELRNEDVQRRLNSIKKLSTIALALGVERTRGELIPFLTDTI
YDEDEVLLALAEQLGSFTPLVGGPEHVFCLLPPLESLATVEETVVRDKAVDSLRKLSEEH
TQTDLENHFVPMVKRLAAGDWFTSRTSACGLFSVCYKKCKNTTKGELRVLFNNLCSDDTP
MVRRAAASKLGEFAKAVESEYVKSDLIPMFNSLASDEQQDSVRLLAVEACVSIATLLSHE
DTELLIMPTMRGCAEDKSWRVRYMVADKFTELQEAVGPEITKQDLVPAFQSLLKDCEAEV
RAVAAHKVKSFCEKLAPNSREQIIMASILPCVKDLVSDANQHVKSALASVIMGLSPILGK
DNTIQHMLPLFLAQLKDECPEVRLNIISNLDCVNKVIGITQLSQSLLPAIVELAEDNKWR
VRLAIIEYMPLLAGQLGVEFFDEQLNKLCMAWLVDNVFAIREAATNNLKKLVEKFGTAWA
QRTIIPHILGMSRDSNYLHRMTCLFCMNVLIDVVTPEVLSREMLPIINSLAEDAVANVRF
NVAKTLQKMGPFIEASLCQTQSSQCLDKLNTDTDVDVKFYAQEAMAALSIK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaaagaaacagcagatgactccctgtatcccatagctgtgctcattgatgag
cttagaaatgaagatgtacagaggagactcaacagtatcaagaaattgtccacaatcgct
ttagctttgggtgtagaaagaacaagaggggaacttataccattccttacagatactatt
tatgatgaagatgaagtcctcctggccctggcagagcaacttggttcttttactcccctg
gtcggtggtccagagcatgtattttgtttattgcctccccttgaaagcttagccactgta
gaagagaccgttgtgcgagacaaggctgtggacagcttgaggaagctctcggaagaacac
acccagactgaccttgagaatcactttgtaccgatggtcaagcgtctagcggcgggggac
tggttcacctctaggacatcagcatgcggtctgtttagcgtctgttacaagaaatgcaaa
aacacaacaaagggagaattacgagtgttgtttaacaacctatgtagcgatgacacccct
atggtacggagagctgctgctagcaaacttggtgaattcgccaaagctgtagaatctgaa
tatgtcaagtcggatcttattcctatgttcaacagtctggctagcgatgaacagcaagac
tctgtgcgattgctggccgtggaagcttgcgtgagcatcgcgaccctgctctcccacgaa
gatacagagctcctcatcatgcccaccatgagaggctgtgctgaagacaagtcatggaga
gtgaggtacatggtcgctgataagttcacagagttgcaagaagcggtaggtccagagatc
accaagcaagacctggtcccagcattccagagtcttctgaaggactgtgaagcagaggtc
agggctgtggctgctcacaaggtcaaatcattctgtgagaagctagctcctaactctaga
gaacagatcatcatggccagcatcttaccctgcgtcaaggatcttgtgtcagacgctaac
cagcatgtgaagagcgccctcgcgtccgttatcatgggcctctctcctattctgggcaaa
gataacaccatccagcacatgttacccctgttcctggctcagctgaaggacgaatgccca
gaggtcagactgaacatcatcagtaacctagactgcgttaacaaggtgatcggcatcacc
cagctctcacagtctctactaccagccattgtagaactagctgaggataacaagtggaga
gttcgacttgctatcatcgagtacatgccactactggctggacaattgggtgtagagttc
tttgatgagcagctgaataagctttgcatggcatggttggtggataatgtattcgctatc
agagaagctgccacaaacaacctgaagaagctggtagagaagtttggcacagcatgggct
cagaggaccatcattcctcatattcttgggatgtctcgtgattctaactacctgcatcgt
atgacctgcctcttctgtatgaatgtcctcatcgatgtggtcactccggaggttctcagt
cgggagatgttgcctatcatcaactctctcgctgaggatgcggtggccaatgtacgtttc
aacgtcgctaagactctccagaagatgggcccttttatcgaagcaagtttgtgtcagact
caatcaagccagtgccttgataagctgaatacagatacagatgtcgatgtcaaattctac
gcccaagaggcaatggcagcactctctatcaaatag

DBGET integrated database retrieval system