KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584312Help
Entry
584312            CDS       T01019                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    584312
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     584312
Protein phosphatases and associated proteins [BR:spu01009]
 HAD phosphatases
  Other HAD phosphatases
   584312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 584312
NCBI-ProteinID: XP_030837935
Position
Unknown
AA seq 258 aa AA seqDB search
MIICGHAFGLFFSTCDNLENFKMSTPEPKAQITHVIFDMDGLLIDTERLYTIVYDKVCGK
YGKTFTWEIKQKLMGRKTMESAQMIIDILKLPVNAEQWVREISDEMTTIMPDAKLLPGAD
RFVRHLHKHSIPIAVATGSSTPAYDLKTTHHKDFFNLFHHIVCSGDDLAVHHGKPAPDIF
QVASNRFKENPPASPRNVLVFEDAPNGVLSGKAADMWVVMIPDERLIGTDDTISADQVLK
NMEDIIPEEWGLPPFNQS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgataatctgcggccacgcgtttggccttttcttttctacttgcgataacttggagaac
ttcaagatgtcaactccagaacctaaagctcaaattacccatgtcatctttgacatggat
ggattgttgatagacactgagcgcttgtatacgattgtctacgataaagtctgtgggaag
tatggcaagacttttacatgggagatcaagcagaaactgatgggaagaaagacgatggag
tccgctcagatgatcatcgatattcttaaactgccggtgaatgcagagcagtgggtacga
gagatcagtgatgaaatgaccacgatcatgcctgatgcaaaacttcttcctggtgctgat
agatttgtacgtcatttacacaagcattctatccctatcgccgttgctaccggttcctct
acgccggcatatgacctgaaaacaacccatcacaaagacttcttcaacctgttccatcac
atcgtctgctctggtgatgaccttgcggtgcaccatgggaaacccgctccggatattttc
caggttgcgtccaatagattcaaggagaatccaccagcatcacccaggaatgttctcgtc
tttgaagatgctcccaacggcgtgttatcaggtaaagcagcggacatgtgggtcgtgatg
atcccggatgagaggctcatcggcactgatgataccatctcggctgatcaagttctcaag
aacatggaagatattataccggaggagtggggtttgccccccttcaatcagagctga

DBGET integrated database retrieval system