KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587532Help
Entry
587532            CDS       T01019                                 

Definition
(RefSeq) beta-galactosidase
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00052  Galactose metabolism
spu00511  Other glycan degradation
spu00531  Glycosaminoglycan degradation
spu00600  Sphingolipid metabolism
spu00604  Glycosphingolipid biosynthesis - ganglio series
spu01100  Metabolic pathways
spu04142  Lysosome
Module
spu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    587532
  Lipid metabolism
   00600 Sphingolipid metabolism
    587532
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    587532
   00604 Glycosphingolipid biosynthesis - ganglio series
    587532
   00511 Other glycan degradation
    587532
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    587532
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     587532
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   587532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Xan_ur_permease
Motif
Other DBs
NCBI-GeneID: 587532
NCBI-ProteinID: XP_792349
UniProt: W4XVP4
Position
Un
AA seq 671 aa AA seqDB search
MGRLRSYVSKLLICMAVLAVKQALPDRSFTIDYDSNTFLKDGQPFRYVSGSFHYSRVPAF
YWQDRLDKMKMAGLNAVQTYVIWNFHELKPGEFNFDGDHDILSFLKKANDTGLAVILRPG
PYICGEWDLGGLPAWLLNIPGIVLRSSNDLYMAHVTEWMNFFLPKLRPYLYVNGGPIIMV
QVENEYGSYQTCDHQYQRQLYHLFRANLGPDVVLFTTDGPGDHLLQCGTLQDMYATIDFG
AGSNSTGMFQEMRKFEPKGPLVNSEYYTGWLDHWEHPHQTVKTAAVCTSLDQMLALGANV
NMYMFEGGTNFGFWNGANYPTFNPQPTSYDYDAPLTEAGDPTPKYMAIRNVIGKYLPLPA
GPIPPPTKKYAYGVVEMEFTATIYDVLDQLCPYGPIMTDYPITMEAMQQYQGFMLYRTKL
PQNYATPANLTIEGIRDRGYVIIDQVWVGTLNRVNATSMNITGSEGMTLDIFVENQGHIN
YGSGLYDPKGIISNVTLDGAILQKWSIYSLDLDNILPKLQSLHRQRNRKMGNFIQERAPH
WRDGGYVPSFYLGSFPNLSAIDPPQDTFLKSSGWTKGQAFINDFNLGRYWPRAGPQVTLF
VPANLLRPSPVQNTVLFLELERPPCFNQTETCTVEFIDRPIINSTVAARPDETFRDRKYI
PEGHDFTDLRH
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgggaagattacgttcttatgtctcaaagttactaatttgcatggcggtattggctgtg
aaacaggcgctcccagatcgctccttcaccatcgactacgacagcaacactttcctgaag
gatggccagccgtttcgctacgtctctgggagctttcactacagcagggttccagcattc
tactggcaggacagactggacaagatgaagatggctggattgaatgcggtccagacatat
gtgatctggaacttccatgagctcaagcctggagagtttaactttgatggtgatcatgat
atcctctcgtttctcaagaaggccaatgatacaggtctagccgtcatcctcagacctggg
ccctacatctgtggagaatgggacctgggaggacttcctgcatggcttctcaacattcct
ggcattgtccttagatcatcaaatgatttatacatggctcatgtcacagaatggatgaat
ttctttctgccaaagctccggccgtacctttacgtcaatggagggcctatcatcatggtc
caggtcgagaatgagtacgggagctaccagacatgcgaccaccaataccagagacagctc
tatcacctgttccgtgccaatctgggtccagacgtggtcctcttcaccacggacggacca
ggggatcaccttctgcagtgtggcacgctgcaggatatgtacgcaacgatagactttggt
gcaggatccaattccacaggaatgtttcaagaaatgaggaaatttgagccaaaggggcct
ttggtcaattcagaatactacacaggctggttggaccactgggagcacccacatcaaacc
gtgaaaacagcagctgtctgtacatcacttgaccagatgcttgctttaggcgctaatgtg
aacatgtacatgtttgaagggggcaccaactttgggttctggaatggagcgaactacccg
acctttaacccccagcctaccagctatgactatgatgccccactcacagaggcaggagac
cccaccccaaagtacatggcaatcagaaatgtgatcggaaagtatcttcctctacctgct
ggacccataccccctcccaccaagaagtatgcctacggggtggtggagatggaattcaca
gcaaccatctacgacgtcttggatcagctgtgcccttatggaccaatcatgacggactat
cccattaccatggaagccatgcaacagtatcagggattcatgctctatcgtaccaagcta
ccgcagaactacgctactcctgcaaacctgaccatagagggcatcagagacaggggctac
gtcatcattgatcaggtttgggttggaacgttgaacagagtaaacgcaaccagtatgaac
atcacaggaagtgaaggaatgacccttgacatctttgtagagaaccaaggtcatatcaac
tatgggtcaggactttatgaccccaagggaatcatcagtaacgtcaccttagacggtgcc
atccttcaaaaatggtccatctattccttagacctggacaacattcttccaaaactacaa
tccctccatcgtcaacggaatcgcaagatgggaaacttcatccaagagagggcgccacac
tggagagatggaggctacgtaccatcgttctatctagggtcatttccaaatctttcagcg
attgatccaccgcaggataccttcttgaagtctagtggatggacaaagggccaagccttc
atcaacgacttcaatctgggcaggtactggcctcgggctggaccccaagtcacactcttt
gttccagccaacctacttagaccaagtccagtccagaacacggtcctattcttggaacta
gagagaccaccttgctttaatcagactgaaacatgtactgtagagtttatagatcgacca
ataatcaattccactgtcgctgctagacctgatgagacattcagagacaggaagtatatt
cctgaagggcatgattttactgatctcaggcattga

DBGET integrated database retrieval system