KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588379Help
Entry
588379            CDS       T01019                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    588379
Enzymes [BR:spu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     588379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF5024
Motif
Other DBs
NCBI-GeneID: 588379
NCBI-ProteinID: XP_030841318
Position
Unknown
AA seq 489 aa AA seqDB search
MKYVGTRSDEFGKFSFEEAIFSPGYLPDGGLLIPEVIPELSASSLQEWSSLSYAQLCKKI
FPLFVGEDEVPTSDLNDIVDQAVAKLKHPKVSKVTRLSNGLNVAELFHTRTLAFKDLSMV
TLGQFMKYFLAKRKKNIILIVGTSGDTGSAAIEAIRDHDYIDFIVLVPHCSRLQKLSMFT
AVDRNIHIFHGPNMSSDDCDVVIKPVMTDTAFKERHELGTLNSINWGRVMGQIVNYFFTY
FSMCPSCDKVVEMVIPTGACGNMTGACIAKKMGLPIKIVCAVNSNDIVHRTFGHNDYSTN
EVKPTISPAMDIQIPYNVERVMWLFSGGDRAHIKDVMSKFEKDGKATMDSVLWKKIRETV
SSYSVDDDTVKETIRRCWKEESYALCPHTAIAVAYYYHKLANPDPSSPSISVCLATASPA
KFPEAMEAAGLPDVASEEVDRWLSLPARFSKLLQDGTEEKVLRARIEGITAAREAGLTGD
LYESGHLVL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgttggcacaagatcagacgaatttggcaaattttcgttcgaagaagcgata
ttctctccgggctatttaccagacggagggcttctcatacccgaagttatccccgagctc
tcggcgagctctctgcaagaatggtcctcactctcgtacgcccaactctgcaagaagata
ttcccgctgttcgtcggcgaagatgaagtcccgacttctgatttaaatgacattgttgat
caagctgttgccaaattgaagcatccaaaagtgagcaaagtgacaaggttgtccaacggc
ctgaacgttgcagagttattccataccaggaccctggccttcaaggacctgtctatggtg
accctgggccagttcatgaagtactttcttgcaaaaaggaagaagaatattatccttatt
gttggcacttcgggggacacaggaagtgcagctattgaagccatcagagatcatgactac
atcgatttcattgtactggtacctcactgttctcggctccagaaactctccatgttcaca
gccgttgataggaatatccacatcttccatggacccaacatgtcttctgatgattgtgat
gttgtgatcaagcctgtcatgaccgatactgcttttaaagagcgtcatgagcttggtact
ctcaactccatcaactggggcagggtgatgggtcagattgttaactacttcttcacctac
ttctccatgtgtccatcatgtgacaaggttgtcgagatggtcattcctacaggtgcctgt
ggcaatatgaccggtgcatgtatagcaaagaagatgggactacctatcaagattgtgtgt
gctgtcaacagtaatgatatcgtccacaggacattcggtcacaatgactactctacgaat
gaagtaaagcccaccatctccccagctatggacatccagataccatacaatgtggagaga
gtgatgtggctgttttctgggggagaccgcgcccacatcaaggacgtcatgtccaaattt
gagaaggatggaaaagcaactatggattccgttctttggaaaaagatacgagagactgtg
agctcctactcggtggatgatgacacggtcaaagagactataagaagatgctggaaagaa
gaatcctacgcactttgccctcacacagctatagctgttgcttactactaccacaaactt
gctaacccagaccccagctctccatccatcagcgtctgcctagcaaccgcatcgcccgcc
aagtttcccgaggcgatggaggctgccggcctacccgacgtcgcttcagaagaggtggac
aggtggctgtcgttgccagctcgtttttccaagctgctgcaggacgggacggaggagaag
gttctacgagccaggatagagggcatcacagcggccagggaggcgggtctgacgggggat
ctctatgaaagtggccatctggttctctaa

DBGET integrated database retrieval system