KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588471Help
Entry
588471            CDS       T01019                                 

Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04068  FoxO signaling pathway
spu04350  TGF-beta signaling pathway
spu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:spu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    588471
   04068 FoxO signaling pathway
    588471
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    588471
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:spu04052]
    588471
   00536 Glycosaminoglycan binding proteins [BR:spu00536]
    588471
Cytokines and growth factors [BR:spu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   588471
Glycosaminoglycan binding proteins [BR:spu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   588471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta DAN
Motif
Other DBs
NCBI-GeneID: 588471
NCBI-ProteinID: XP_793246
Position
Unknown
AA seq 432 aa AA seqDB search
MFSSSSTSSSIRCCLAASWLGLAVLSLTFDGLGAGGQCKFDLQEYQDRRIAAIKGQILSK
LGLTALPTDDGPEDVPKDILDLFNQTVTLLEEKYENEREQCKGLSGGSDDYFAQLPILYG
IVETDIEKDIGNYATVKRLSKFFRFDLTSFEEDSQGDEVTEAEFRLYQVPNEMKDTEQQI
DLFQLITSYNSTEEPTRRFLTSWTVSTTREGWLAHDVTDVVREWVADPETNLGFELNLNC
GDYLLGPTTTTPASIPKDQHKLHVLFADPRGTFPSMDNGRGDGNPRGEGFPSINHPRLVV
MTPANHSRGSESNSVRKRRSTSYSGSQCDQNSPNCCLRPLVINFRRDLKWNWIRQPRNYS
PNFCAGSCPYILSADTSHASVLSLYKHLNPDASPSPCCSPQTFKPLTILFYNRGRPEIRQ
LNNMIIETCRCS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcaagcagtacatcctcctccatacgctgctgtctggcggcgtcgtggctg
ggcctcgcagtactttccctcacctttgacggcctcggtgccggtggacagtgcaagttc
gatctgcaggagtaccaggaccggcggattgccgccatcaagggacagatcctcagtaaa
ctgggcctcaccgccctgcccaccgatgatggaccagaggatgtgcctaaggacatactg
gatttatttaatcaaacagtgacactgctcgaggagaaatacgaaaacgagagggaacag
tgtaaggggttgtcaggcggtagtgatgactatttcgcgcaattgcccatcttatatggt
atagtggaaactgatattgaaaaagatattggcaattacgcgacggttaaacgactatca
aaatttttccggttcgacctcacgagtttcgaagaggacagccagggtgacgaagtgaca
gaggccgagttcagactctaccaagttcccaatgaaatgaaggatacagaacaacaaatc
gacctctttcaactcataacatcctacaacagtacagaggaaccgaccaggcgattctta
acgagctggacggtatcgacgactagggaaggatggctcgcgcatgacgtcaccgatgtc
gtgagggaatgggtagctgatccagaaacgaaccttgggtttgagttgaacctgaactgt
ggtgactatctgcttggacccactaccactacaccagcttccatcccaaaggaccagcat
aaactacacgtcttgtttgcagaccccagaggtacctttccgagtatggataatggacgt
ggcgacggcaaccctagaggtgaaggattccccagtatcaaccatcctagattggtcgtc
atgacccctgccaaccattcacgaggaagcgaaagcaacagcgtccgaaagcgacgaagc
acctcgtacagcggctcccagtgcgaccagaactcacccaactgctgccttcgcccgctc
gtcatcaacttcaggcgcgatctcaaatggaactggatccgacaaccccgcaactattcg
ccaaacttctgcgcgggatcttgcccctatatcctgagtgccgacacgtcccatgcttca
gttctatcgctttataaacatctcaatccggacgcgagcccctcgccatgctgttctcct
caaacattcaaacctttaaccatccttttctacaacagagggcgtcccgagatcaggcaa
cttaataacatgattatagaaacttgtagatgtagctag

DBGET integrated database retrieval system