KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588537Help
Entry
588537            CDS       T01019                                 

Definition
(RefSeq) heat shock 70 kDa protein IV-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03040  Spliceosome
spu04141  Protein processing in endoplasmic reticulum
spu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    588537
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    588537
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    588537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    588537
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spu03041]
    588537
   03009 Ribosome biogenesis [BR:spu03009]
    588537
   03110 Chaperones and folding catalysts [BR:spu03110]
    588537
   04131 Membrane trafficking [BR:spu04131]
    588537
   03051 Proteasome [BR:spu03051]
    588537
   03029 Mitochondrial biogenesis [BR:spu03029]
    588537
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spu04147]
    588537
Protein phosphatases and associated proteins [BR:spu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     588537
Spliceosome [BR:spu03041]
 Complex B
  Other components
   Prp19 complex
    588537
 Complex C
   Prp19-CDC5 complex
    588537
Ribosome biogenesis [BR:spu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    588537
Chaperones and folding catalysts [BR:spu03110]
 Heat shock proteins
  HSP70 / DNAK
   588537
Membrane trafficking [BR:spu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    588537
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    588537
Proteasome [BR:spu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    588537
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    588537
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   588537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Ppx-GppA StbA Hydantoinase_A DUF1464 Sec_GG
Motif
Other DBs
NCBI-GeneID: 588537
NCBI-ProteinID: XP_030854112
Position
Unknown
AA seq 623 aa AA seqDB search
MAPGKAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPKNTIFDAKRLIGRTFTDDNVQSDMKHWPFTVINKGGKPMLLAEYIGEQKTLAPEE
ISSMVLIKMKETAEAYLGKKITDAVITVPAYFNDAQRQATKDAGVIAGLNVLRIINEPTA
AALAYGLDKKLKGEQHVLIFDLGGGTFDVSILVIGDDIFEVKSTAGDTHLGGEDFDDRLV
DYLAEEFKRKHRKDMRSNPRSLRRLRTAAERAKRTLSSSTTANIQVDSLYEGIDFSTSVS
RARFEELCSDLFKKSLQPVERAISDAKIDKNKIDTVVIVGGSTRIPKIQKLLQEFLNGKD
LNKSINPDEAVAYGAAVQAAILSGDQSEEIKDVLLVDVTPLSLGIELTGGVMSKLIERNT
NIPTKAAETFTTPADNLPALDIRVFEGERAMTKENNRLGQFEFSGIPLAPRGVPQIEVTF
DIDANGIMHVTAKDESTGRSNKITITNDRGRISKDEIERMINDAERFKAEDDAQRERIAA
RDQLESFAYNVKSAINDASVERQVSSSDKEFVIKAFDDVITWMDNNSLAKKEELSFKLKE
LQKTCSPIMAKLHAGSNSGHPGQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaggaaaagcaccagcgattggaattgatctgggtaccacctattcttgtgtt
ggggtctttcagaatgggaaggtagagatcattgctaacgatcaaggaaaccgaaccaca
cctagttatgttgccttcacagatacagaaagattgatcggtgatgctgcaaagaatcag
gtggcaatgaatcccaagaacacaatcttcgatgccaaacgtcttattgggaggacattc
acagatgacaatgtgcaatcagacatgaagcactggcctttcaccgtcatcaataaagga
ggcaagccaatgctactggcagagtacataggagaacagaagacattggctccagaagaa
attagctcgatggtcttgatcaagatgaaggagacagctgaggcttatcttggcaagaag
atcactgatgccgtcatcactgttcccgcttacttcaacgatgcacagcgacaggcgacg
aaggacgcaggtgtgatcgctggcctcaacgtcctcagaatcatcaacgagcccaccgct
gccgccctcgcctacggactcgataagaagctgaagggggagcaacatgtcctcatcttc
gatctcggtggtggtacgttcgatgtctcgatcctggtcattggtgatgatatcttcgaa
gtgaagtcgacagccggtgacactcatctcggaggagaagacttcgatgatagactagtc
gattatcttgctgaggagttcaagcgaaagcataggaaagacatgaggtccaacccaaga
tcgctccgtcgcctccgaacagcagcagagcgagcaaagagaacactgtcaagcagtact
acagcaaacatccaagttgactcactctacgaaggtatcgacttctcaacaagtgtcagc
agagcacgattcgaggagctgtgttcagatctattcaaaaagagtctgcagccagtggag
agggccatcagtgatgctaaaatcgacaagaacaagattgacaccgtggtaattgtaggt
ggatcaacacgaatcccgaagatccagaagctcctccaggaattcctcaacggaaaggat
ctgaacaagtctatcaatcctgatgaagctgttgcctatggtgctgctgtccaagctgcc
atcctctctggcgaccagagcgaagaaatcaaagatgttcttctagtcgatgtgacccct
ctctctcttggcattgaattaacaggaggtgtgatgtcaaagctcattgaaaggaacaca
aacatccctacaaaggctgccgagaccttcactactcctgcggacaacctgcctgcctta
gatatcagagttttcgaaggagaaagagctatgaccaaagaaaacaatcgacttggccag
tttgagttttccggtattcctcttgcacctcggggcgtccctcagatcgaagtcactttc
gacatcgacgccaacggcatcatgcacgtcactgccaaggacgagagcacgggtcgtagc
aacaagatcaccatcaccaacgacagaggaaggatatctaaagacgaaatcgagcgcatg
atcaacgatgccgagagattcaaggccgaagatgatgctcagcgagaacgcatcgcggcc
agggaccaactcgagagctttgcctacaacgtcaagtccgcaatcaatgacgcatcggta
gagcgccaggtcagctccagcgacaaggaattcgtaataaaagcatttgatgacgtcatc
acttggatggataacaactctttggcaaagaaggaagaattgtcgttcaagttgaaagaa
ttgcagaagacatgctctcccatcatggctaagttacacgcaggcagtaactcaggtcac
ccgggacaataa

DBGET integrated database retrieval system