KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588724
Entry
588724            CDS       T01019                                 
Name
(RefSeq) ATP-binding cassette sub-family A member 5 isoform X1
  KO
K05648  ATP-binding cassette, subfamily A (ABC1), member 5
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    588724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spu02000]
    588724
Transporters [BR:spu02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA5, 6, 8, 9, 10 subgroups
    588724
SSDB
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 SMC_N AAA_23 AAA_30 AAA_29 RsgA_GTPase ABC2_membrane SbcC_Walker_B SRP54 AAA_15 GTP_EFTU Ploopntkinase3
Other DBs
NCBI-GeneID: 588724
NCBI-ProteinID: XP_030840599
Position
Unknown
AA seq 1546 aa
MPDVSIRMFPKGQFDFSLDSLRITVSVYIVLAYMPFTAVLLTTLVIEKERKIKEVMKIMG
LNNVTFWLSWIIVYIGIVFIVGIIIAGFSKAITLFPDGNFFLIFLGLFFYGLSVVTMSFM
FSPLFKKATTAGGAGSFFIMLFVIPYIPLAILGPETVPAGLLWILCLFSPTAIAFFMDRC
VLFEQISNGVQFSNLGDGYFPPYAPLVMIFVDIILYLLLAIYLENVVPGAYGQSLSPVFF
LKPSYWRGSSDKGPNDHTGLLQDNNGSEHTATNDDALVEPVPAAMRGRNGIRIRNVKKTF
RGKGGKPDVQAVNGISLDIYEGQITCLLGHNGAGKSTLMSCLTGMLGATEGQATAYGADM
FDPAGVEKIRSMTGVCLQENTLLDLLTPEEHLKFYAGLSGIPKAQIPDKVEEALDQIDLK
NQRATFAKDLSGGQKRKLCVGIAIIGNPKILFLDEPSSGMDPYSRRKMWSLLKKQREGRV
TLLTTHFMDEADILADRKAIISKGQLKCYGSSLFLKNKFGVGYRLGLVKESNCDQDKITD
VIQTHIPEASITRSHGMELAYSLPLKDVSSFSGMFKSLEEKSADSSLGVQSYGVSMTTLE
EVFLKIGEEAEIDEADAAKKQVAEHTSKTKKNQIAIEATQINLSTPSIGTSGPGPTPDVP
PSAVSGMTMEDSGSGAGASVTVNMEQSPLDSTIMATQPIIVQHNEQLKSLIRIEAVRAAR
NPATYVCRLILPIILMIVGGVLSLVITFGGDGPSDAPAPLVFTPSMYFSAPGASMDEKST
DLLYHNSLPNGQNIADLVAEFDNLNIESNATADLNALYDYRPHNGAFDVIDLGTTGSASQ
FTAYYNDTALHSLPVVLSIMSSALLNLYGNASVITAASHPFPKPAGTPEYTFTSGILFVY
IFGLGAAWSLMGFPIDRVKERETKVKAQLRISGIDTLSYWGSVFVIDVAQMLLVIIIGLI
IIFAMQVPSLTTGGAAFCLLVTVILWVPNAIVHTYCISFIFDKFETVQSYAFVIFVEIPL
FLFLPTMFIDLYVSTAAAASFHLVMCVIWPGYAIFGSLYFIDKVYQLASIRGMADSVTFA
DYFAPEAYIWPTMLILLFDMFMLIFFLRFCEVVKAGGRVKDTCPCLVAKKIGVTTRNDDN
IPDEDSDVKEERMKVEEMYESDQSSAVAISELRKEFVKRGDSKATTKVAVRNLSLTVQTG
EVFGLLGPNGAGKTTTMNVVTADTEATNGQVRVGGYDVSSSLSDAYASMGYCPQIDPLWD
DITMREHLEGFAGFKGIHPTDRRQIANNFMSAIGVMEHADKKAKELSGGTKRKLCFALSM
LGNPKIVLLDEPSTGMDPSSKRFLWNVITSSFLEKKGAILTTHSMEEADAVCSRVGIMIQ
GQLRCLGTTQHLKDKYGGGYILEIKLNPGVQYYTSDQTTTAVMDILDEKMDILHKQVMLL
IPQAEVTESFAERITYKIPRDSSITLSTIFAFLEQGKEDYGIEEYSFSQTTLEQVFIDFA
KTQVDNPDEEAELVTVAAQENGSNRPGSRHSVRHAPTPQTSVNMEV
NT seq 4641 nt   +upstreamnt  +downstreamnt
atgcccgacgtatccatccggatgttccctaagggccagtttgacttttctctggactcg
ctgcgtatcacggtgtcggtctacatcgtgctggcttacatgccctttacggccgtcctc
ctgaccacgctggtcatcgagaaagaacgcaagatcaaggaggtgatgaagatcatgggg
ctcaacaatgtcaccttctggttgtcatggattatcgtgtacatcggcattgtgttcatc
gttggtataatcattgcaggattcagcaaggccatcacgttattccccgatggaaatttc
ttcctcatattccttgggctcttcttttatggcctctcagtggtgacgatgtctttcatg
ttctcgccactgttcaagaaggccaccactgcgggaggcgcaggtagcttcttcataatg
ctcttcgtgattccgtacatccctcttgccatcctgggcccagagacggttcctgctggg
ctgctctggatcctctgtctcttctctcccactgctatcgctttcttcatggataggtgt
gtgctgtttgagcaaattagcaatggggtccagtttagtaaccttggagacggctacttt
cctccgtatgctccgcttgtgatgatctttgtggacatcatcctgtacctgctcctggca
atctacctggaaaatgttgtccctggagcttatggccagagcctgtctcctgtgttcttc
ctgaaaccctcctattggcgtggcagcagtgacaagggtccaaatgaccatactggactc
ctgcaggataataacgggagtgagcatacagctaccaatgatgacgcactggtcgaaccc
gtcccagcagctatgagagggagaaatggaataaggattcgcaacgtaaagaagaccttc
cgaggaaaaggtggcaaaccagatgtccaagcagtgaatggtatttctctggacatctac
gagggtcagatcacctgtctcctgggtcacaacggggcgggcaagtccaccctgatgagc
tgcttgaccggtatgctcggggccactgagggtcaggccaccgcctacggagcggacatg
tttgacccagccggcgtggagaagatccgcagcatgaccggtgtgtgcctccaggagaac
actctcctggatctcctcactcctgaagagcatctcaagttctatgcaggactctcagga
atcccaaaggcacagatcccagacaaggtggaagaggctctggatcagattgacctcaag
aaccagcgagcgacctttgccaaggatctgagcggaggtcagaagcggaagctctgtgtc
ggaatcgccattatcggtaaccctaagattctctttttggatgagcccagcagcggcatg
gacccgtactctcgacgtaagatgtggtctcttctgaagaaacagagggaaggaagggtg
actctcctcaccacacactttatggatgaagccgatattctagcagatcgtaaagctatt
atctccaaggggcagttgaaatgctacggctcgtccttgttcctgaaaaacaaatttggt
gttggataccgtctcggccttgtgaaggagagtaactgtgatcaagataagataaccgac
gtcatccagacacacattcccgaggcctctatcacacgatctcatggcatggaactggcc
tacagcttacctctcaaagatgtctcttccttctctggcatgttcaagagcctggaggag
aagtcagcagattcatcgttgggcgtccagagttacggtgtttccatgacaaccctagag
gaagtcttcctgaagatcggagaggaagctgagatagatgaggcggatgcagccaaaaag
caagttgctgaacatacctcaaaaacaaagaaaaaccaaatcgctatcgaagccacccaa
atcaatctatcaacaccatctatcggaacctctggccctggaccaacccccgatgtccca
ccaagtgcagtatctggcatgaccatggaagactctggatctggagccggtgcctctgta
acggtcaacatggagcagtcccctctagactccaccatcatggctactcaacccatcatt
gtgcaacacaacgaacagctcaagagtctgatccgcatcgaggcagtccgggctgccagg
aaccccgcaacatacgtctgtcgactgatcctacccataatactgatgattgtgggtggt
gtcttgtcactcgtcatcaccttcggtggagatggaccgagcgacgcccctgcccccctc
gtcttcaccccatccatgtatttctcggctccaggggctagcatggatgaaaagtcaacc
gatctgctctaccataattcactgccaaatggtcaaaatatagctgacctagtggcagag
tttgacaatctgaacattgaatcaaatgctacggccgacttaaatgccctctatgactat
cgaccccacaatggtgccttcgatgtcatcgatcttggaacgaccggctctgcaagccag
ttcactgcatactacaatgacacagccctgcactcgctccctgtggtgctcagcatcatg
tccagtgcccttcttaatctctatggcaacgcatcggtcatcacagccgccagccatccc
ttccccaagccggccggcacaccagagtacaccttcaccagcggcatcctcttcgtctac
atctttggcttaggagccgcctggagtctcatgggattccccattgacagggtcaaggaa
agagagacgaaagtcaaagctcagctccgcatctctggtatcgacaccctctcctactgg
ggctccgtcttcgtcatcgacgtcgctcagatgctcctggtcatcatcatcggtctcatc
atcattttcgccatgcaggtgccctctctgacgacggggggcgccgcgttctgtctcctc
gtgacggtcatcttgtgggtgcccaacgccatcgtccacacctactgcatcagcttcata
tttgataagtttgagacggttcagtcgtatgcctttgttatctttgttgagataccattg
ttcctctttctacccacgatgttcattgacctgtacgtctcaacggctgccgctgccagc
tttcacctggtcatgtgtgtgatctggccaggctacgctatctttggatctctctacttc
atcgacaaggtctaccaacttgcctccataaggggaatggcagatagtgtcacctttgcg
gattactttgctcctgaggcatacatctggcccacaatgctcatattgttgtttgacatg
ttcatgctcatctttttcctgagattctgcgaggttgtgaaagccggtggcagagtgaag
gacacctgtccttgtcttgtggcaaagaagattggcgtgacaaccagaaatgatgacaac
atcccagacgaggatagcgatgtcaaggaggagaggatgaaagtggaagagatgtatgag
tcagaccagtcctctgccgttgccatctccgagctcaggaaggagtttgtgaagcgaggc
gacagcaaagctacgaccaaggtggctgtgcgtaacctgtctctgacggtacagacgggt
gaggtctttggtctactgggacccaacggtgcaggcaagaccaccaccatgaacgtggtc
acagctgatacagaggccactaatggacaggttcgtgtaggaggctatgacgtgtcttcg
tctttgagcgatgcctacgcctccatgggctactgccctcagatagaccccctctgggat
gacatcacaatgagagaacatctggaagggttcgcagggttcaaaggtatccatcccacg
gacaggaggcaaattgctaataatttcatgtcggctatcggagtaatggagcatgctgat
aagaaggccaaggaattatctggaggaactaaaagaaagctatgctttgccttgagcatg
ctgggtaatcctaagattgttctcctggacgaaccctcgactggtatggatcccagctcc
aagagattcctctggaatgtcatcacttccagtttccttgaaaagaaaggagccatctta
acgacccattccatggaggaggctgatgctgtgtgctccagagtgggcatcatgatccag
ggacaactcagatgccttggcaccacgcagcatctcaaggacaagtacggcggtggctac
atcctggagatcaagctcaatcccggcgtccagtactacaccagcgaccagaccactacg
gccgtcatggacatcctggacgagaagatggacatcctgcacaagcaggtcatgctcctc
atcccccaggcggaggtcactgagagctttgcggagcgcatcacatacaagatccctcgg
gacagcagcatcacgctctccaccatcttcgccttcttagaacagggtaaagaagattat
ggtattgaggaatacagcttcagtcagactacgttagagcaggtgttcattgactttgcc
aagacgcaggtagacaatcctgacgaggaggcagagctggtgacggtagccgcccaggag
aacggaagcaatcgacccggcagcagacacagtgtgcgtcatgcccccacaccacagaca
tcggtcaatatggaagtttag

DBGET integrated database retrieval system