KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590007Help
Entry
590007            CDS       T01019                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spu01001]
    590007
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spu04131]
    590007
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spu04812]
    590007
   04147 Exosome [BR:spu04147]
    590007
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     590007
Protein kinases [BR:spu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   590007
Membrane trafficking [BR:spu04131]
 Others
  Actin-binding proteins
   Others
    590007
Cytoskeleton proteins [BR:spu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     590007
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   590007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 THB Pur_ac_phosph_N V-set Pkinase fn3_2 Tissue_fac C2-set_2 Pkinase_Tyr Izumo-Ig Ig_4 Y_Y_Y SH3_1 SH3_9 SH3_3
Motif
Other DBs
NCBI-GeneID: 590007
NCBI-ProteinID: XP_030830392
Position
Unknown
AA seq 24046 aa AA seqDB search
MKPLSDLPVPEQVPYVHEPQLKPAGRKPVETPVSFEGLKKIPKRESPPILYEAPLFPEEV
VQEQRSLVEPLERMPRPQPPAQVKESPIPSREVQPEVYIPFDQLEKTKIKEDQITPQQLR
PSPQASFESFSKLPKPQIPEYPEFEEEVPFDAQPEQQYPVSFPERKPKPEVAVKPRAKQP
THPGRPQVMEELQDTEATVGEETQLHTIIIGLPRPRIQWLRNGRPIDGDRFETIVQEDGT
CILVIKIVLEEDQTVYECRATNPLGTVSSFGNLTVTTQETTTRRTVTETVTTEIYTTDSE
QEQYYPHRTQIEIGPGHDRRTFIPPRQPRPVSSSIEISPEDRTETMTTTTVTETITRYDD
DTLSDITTQRSEYDMYPEYERPSQEIELIIDGVRPHPQRQTATVQGRPRGPEIRERTTID
IDRRAPLAPVEFIIDTREDQPQEEYETITRRKKTTVVTRRDNEEDQEPIEKYSIEYPQEP
RRPVDFSFDLPTPSSVDYSEEEILPRYIEPLKIDVDIPETYEICRGVEDVQQPTPIEVQF
EQEPVEEITLGPEEILPVRRERHEPIELTFSQTPVEEIDLGSEKVLPRKEPKPIELTFEG
AEVEEISLGPEEVLPKVKPKPQKPIEMKFDHAPVEEITLGPERVPSKPYKKPEPFQMEYE
CPSVQDIQLREEQVMPKPKRQPIELTFAHKSTEEIYPGEEVTAPQPEIPLQPEFEELVIP
SEYAPDIPTKQKTFVKQTIVQEVHPQPTKKLPTPEERGRSVLELETRPQPREIELILDLN
QPDDVTRTYTETVTTETTTVTEHEEQPNVEYEELIIPGEPERPRKPTQKAQKKQTEPIYV
EESDLLPEESIPGHSPLSPEDLPFARAAVTRIPPEVMTAPDDVEVSYGDTARLECQITGE
PQPLARWNRDGTPVTGNRYLTLVERDGRVVLVINPVEEVDDTEFECVATNAEGTVSTYAD
VYVQDIPTEKVKSRTEKRPKRTEKVSVSVKPKRRETAEIEIDHEEDRPLKSFEVTVDVPK
PLSPEDVQQRPRGPADVPVQPMQRFKPDKPEFEVLVIPKQPEEEEESITISESVTTVVET
KEVVAPRETTQILIDQKQRPLAPIELTLDVPKEEEPEYEVLVVPEVPEEESVTTVTETVT
TVVETEEYPDKRETTKVQMETQRTPLAPVELTFEAPRHEQPEYEEIVFPAEKPHEQPEYE
VCVIPQERQPEEETVTTVEEIVTTVVETQEIPETHETTQVLLEKKKKPLAPMELTFDIPK
EEKPEYEVLVIPQERQPEEETVTTVEEIVTTVVETQEIPETRETTQVLLEKGKKPLAPVE
LTFDIPREEKPEYEVLVIPQERQPEEETVTTVEEIVTTVVETQEIPETRETTQVLLEKGK
KPLAPVELTFDIPREEKPEYEVLVIPQERQPEEETVTTVEEIVTTVVETQEIPETRETTQ
VLLEKGKKPLAPVELTFDIPKEEKPEYEVLVIPQERQPEEETVTTVEEIVTTVVETQEIP
ETRETTQVLLEKGKKPLAPVELTFDIPKEEKPEYEVLVIPQERQPEEETVTTVEEIVTTV
VETQEIPETRETTQVLLEKGKKPLAPVELTFDIPKEEKPEYEVLVIPQERQPEEETVTTV
EEIVTTVVETQEIPETRETTQVLLEKGKKPLAPVELTFDIPKEEKPEYEVLVIPQERQPE
EETVTTVEEIVTTVVETQEIPETRETTQVLLEKGKKPLAPVELTFDIPKEEKPEYEVLVI
PQERQPEEETVTTVEEIFTTVVETQEIPETRETTQVLLEKGKKPLAPVELTFDIPKEEKP
EYEVLVIPQERQPEEETVTTVEEIFTTVVETQEIPETRETTQVLLEKGKKPLAPVELTFE
VPRTEHPEFEEEVPQQPEYEVVVMPMEQEPEMETITTVTETVTTVVETEDQPDSRQTTQI
EIDQQRQPLAPIELTLEIPKDEKPEYEVLVMPTEQPEEQPEYEILVQPMEQPIDEEVTTV
SETVTTITEVVRTEEVPDAIETTKVIIDQGEQPLAPVELTFEIPEEEKPRIEDVPVQQEY
EVLVMPMEEEEKTMTTVVTETVTTVIETEEIPEVKETSEMFIDQKQPLGQVELTLELSPG
EQPEIGVVQPFTEETVETLSEDVPDRVEAVPQEEAGVQVVVTQEPPQVIRPLEDIVTDVG
ETVRLTSQIVGHPQPDIQWLKHGKPVTGERFVTLIERDGNTVLLISPVKKEDETDFECIG
INEEGTVSTRAEIYLGPKKPRDKPTEKPVKKPEPQKKKPVEQLPITEEVPIPQKVEQEQP
RGPVDLPEKPKHPITEEVPMPQKVKQERPRGPADLPEEPEYEEVVAISEEMVSAEILLMA
GEEPEYEEEIVMPEEEVTEIEITTREVTDVVIEKKPEGVQIEFELPQEKPEETSSTTVTQ
TVTMTIEQEDKGPQRAEVVIDQEQQPLQPIELVLDVREEEMPQMPEYEELVIPSEEMPEK
TERTEIVIDKEEDEQRPIEIVFEAPQQTQVTEEVSTTVTETISEVVETRKDFAPKPTEVV
MEIEVPREPEEPRETTTVIMEKGPEELQGVEFILDISEEPEKPNDKTFIEIIRHVTDIEV
EIGNRAHFTCFILGNPRPTFQWSANGRPLQGDRFISIFNLDGICELIITEVQEEDETVYV
CRAENPAGVVTTEAELIIPGTEGPQEFAPVEITLEKSPESFEEITTKKTTTITTKITEIP
EDIEVQIKDTATKITEEIIRQVTTEHKQGPVVVQELVSQEASPGGIVYLECRFTGTPQPT
FKWYHNGEGLKGERYVVINYNDGVSQLCITEVTKDDHGTFVCEATNPLGNATTVAEIRVY
GTDELPKPGEKAEIILQVEQEAPKDIEIIISPPEFVQPIVDIEVAEGDDVRFKAQVTGSQ
PITITWYQETKPIQESPEFKVAFDGKTCTLEVPEVLPEDAGKYTCKAANPAGEVTSTAVL
TVKDKGPQRMPLDESMRKDLTYPLEQSIPSLSPYQHGDYTSSSSDAESVKEPTDKFGIDE
ILENAVPGFISEEEEDDENKTNGPNRLQPEKGDGLRMDTGLSPGTSDVEDSDKESTTSGE
YDMASPSVLTHEYFHIDPKPGNQSLAPIIEDTEQNNNNEIQTSSDLENNKENKPVPLEEN
MVKETLKPTEKAFRPSFEDLEHSQLKSEDEAEQKEPPEHASKSPDSKTSTDEVEHIDATS
DSVSKLSDSYTSTDEAESSRDGSDDDTSLPERNGQEQTVLEGLSTATGNLLLDVISTEGQ
HSSCDEDYEDEEDDVFLEEKRKASIQQDSEDDEENDYIELSHKDSVVESDYELLLSTGSL
SCEPEKKEKKSSSSSDDDDYTDLVKEVVTGPSPTKAIAYSEFLQQAKKMLEEDESHEDTQ
SESDIKSDVQKTDGNTSPSALSPKEDWQSFTLSLEAKHKLGVVQITRKEEVVVYEQVLEW
REPRKSSDIVLPNQADIPKLRDEENDKIPDYQKYETPEEEKKSEYVEDTFVHPVSPRRTL
PDLSSSDDESIQYAEILPNSLLPRKSLNVALSSKGQEDGSEGQSKDSGDGSSSDESIKVE
QGNIDSIALQFTEKQRIKSQSSSESDGSTLDRSDEDEDDDYDDDHDHSGKELEEEAISPR
NDFTVEASLPREARQTQDSSSTDEREEPGSPHSDLKPADLFLSEIVIPVDGAPLEKSFVF
HLRDHEYGIDEGEPEDSDLDISEGQESSISLAERVVVIDLGSDLEHLSPTLHQSDDDTTA
EECSLGVVSVADTLYQTVELSIPIPKRDHSEDTDDDEDWEDIPRYKTSVELPSPSNEEYF
LPIEVTPSKVQSIHSYLEWTEPREPLHSPVSSESKSFTESDLEQVLDECVSTSDQLDTES
EKEPVMFEEFLSLRREEYTFSMPPKVMQSVDLEINVHDVMSDGDHSKDTDTEKETVESDN
EENNQAATQFKESDPTEMFVSADDFPVEEMSVLGEQSSSSSGSSSPVMLELKMPSSHPDP
DNPETNFVKVRVQESQESLTPAEPLDESSPKMEDTISLTPSQLPDTMSKPDAAPKSQLFT
KTPETNCPGALEDNSKQDLKQESSSAGESVFDSQPDGDDAPLHADDDLVDSVLLDKSSPQ
SPGSQEFLTPQKPLDGSSPKMENTSKPDYTPQSQPITETPETSCPTDLEHNPKQDLTQES
SSIGGNSFDSQPDGDDAPLHADDDLVDSVLLDKSSPQSQESQKSLTPAKPLDESSPKMED
SISLTPSQLPVTMSKPDSAPQSQLITETPETSCPGELEDNPKQDLKQESSSIGGNSFDSQ
PDGDDSPLHAADDLVDSVPLDRSQESLTPAKLLDESSPKMEDTISLTPKMEDTISLTPSQ
IPVTMSKPDFDGDDASCPGALEDNPKQDFTQESSSIGGNSFDSQPDSDDSPLHAADDLVD
SVLLDRSQESLTPVKPLDESSPKMEDTISLTPSQLPVTMSKPDSAPQSQLITEIPETSCP
GALEHIPKPDLKKEPSSIGGNVFDSQSDGDDAPLHAVDDLVDSVLPEEQELHGCLSKAFP
SSPGEKGDEEKPVEDVSRPREEKKPETKQLKPEVEEKTENLTQEILVEKTPKEIMAEELE
AAARGEQPELMPPKFIKPIETVVAGDGDAVKFTATLTGKPRPDVTWYVDDTQIKDEPEYE
VAFTDDGTASLTLPEVIPEDEGMYLCKAVNVVGQATCSAELFVEESKPTEDKPITLERHT
ETRGKSTVSMEIDDTREPRKIELEFKKPEDQEISITMVAPQFTQTIVSVIIKDGQPATFR
AVVTGKPTPDILWFRSGAEIVPEECPEFTITFDTGGVCTLTLEEAFPEDSGPFECRAINP
AGQATCMAKLVVVEESSTEVDTEVEIATSQKVITVTKEVEQTTVIKEEEIQEEMPIAEVK
IEGLESVMVIEPTEPETFIAIGNYLAESDEVMSMREGEQLTILDDGHGEWWMARRERTGE
EGWVPKGYLATADQYDEHLRQQLEEVVKEMSIDELMPPSDAETPFKGMAIAPEIIEPLQT
TKVKDGKPVTLRCRIKGTPMPTLAWFRQSTQIPATEEFKIATDGDIATLTIEEVYPEDSG
KYTCVAKNQAGTSSTSAELLVEVALSDAESDGTPSRKSLSRESTIEEGEGIKPAFMTVAK
SQVVSAGREKVTFEFRLIAAPRPQIQWFKDDQPLEETPRRRMSMYADVHLYILTLELTDI
EPDDEGKYRIVATNKEGKAMASVSLEVTQVDNTSVPVTGFVVSMSSPMSTPAGDRGGWHV
HKIRTWSGSPITISIPSFMHACNRPSDFCMHNDAIYPTMHEDDDENSSEVDHIDSGKEPE
PPKFIEPIQTATVTQGDMARFECVVTGRPMPEITWFHGEKMIKPSDLIEIGQDKEGRNWV
VVRKATPEILGTFTCWAENQVGRTMCGAELTLMSEPEESSIVSVDSSAIVEGPQSRDLVS
VDFEGVDDLDEEGVPPSFVMPVQDVEVKPGETAHLRVKVAGKPTPEVTWYRDGKVLQPSP
RHTIMSDTEGNASLVISETMPGDDADYLCKAVNPFGIVSCRADVIVDEEPSEVKKEKPAI
LVQAEAQPQGPVEVTLEVRGKDLEIASISEAPSITSEEAFETDVEEKELDEAEGAEPEGW
FQDDVQIEIQLEDLGKHPEEVIMEVTKKMEEKSVRQEVVMQVEVTPTREEVTLAPTEVPE
QKAPVFTQPLTTAELKKGETTEITCKVEGQPRPEVQWFVDDKAIEPDTHYQTEHRPDGVC
VLTIHDVESMDEGQYVVRAINPVGVASTESELFVEVPGKMAPVKVEAKATLEVEKPLETI
SKQEAAVVEEQVVPMDKKPTEAAPEVMPQFQLEPTQREIAEVYEAPKFVEDMVDLEIIKG
HPARFDVQVSGIPMPILHWYRNGKEIKPDDQHVKFEFAEDEGIGSLIIDEVRANDDAEYA
CKASNKAGSAVSKADLFLQAAHKKRPEKHPPKFIIDMKSLTAVEGDSINFFCKVVGRPMP
EIKWYKNGVELKLGPRISIDYDEQGMCTLLIRNTTMEDVATFTCKAVNEIGEATTTAELI
LEVPARITDGPKNVSVKRGDSVTVDIHIVGFPQPAVTWYKNSVVVEATERITKETTRETS
QLVISKATMEDAGNYVVVVENELARDELQISITVIDIPAKPQKLEPTQVTPTSTTITWQT
PVMEEEGQEVSSYVVEMLDSATKSWQRIAETLKAPVFTIADLTPGEEYAFRVSASNQFGV
GEPTEKVSVHLPMEKELEDAPREVAEDTLTLQTKAMIPEETTQAAEEVATVEAVEVGKTE
VPTEKALPEEFPEVTVEIPAADAPEVPELLPEEAKPDKAEKRPQNIPPAAEVPVEAPIPE
DNPDDEDRPEEEPISVTIDEGPSESAQFDSDDDDDDEEEEELTEEDLEEEPIVEPELPHD
EGKEPEPEPEKKEKKKKKKKKKKDKEPKLKVQVRELEQPDVEYKRRVFLDTVEEEDEEVK
SPKGRARAILRKKKPIIDETAVIDVEKAPQAPKDQEATILVTKKPTEVALSAQEAPEDIT
DIGISAITPDSKDVLVEKAVPDEKPVVTIAEAKPQVTEPRETAEIVLPIDVQSEKAEAVL
RVGKPQEAEEMQEMHIEVGVEKVKPEEAVTLEMPLEKAEVREAAPVIVDKLKDQTVKTGA
PILLTCKVAGEPVPDVEWYKEGKLLEPTPTQTQTYAAGVATLEILQAKPADQGKYECMAV
SDVGEDTSSAQVTVKIEKPKPTKPSFSETTITIEVTEGEDATFKFTIEGFPCPTLTWNKG
WKAVKPSAQYIIESDETSGETIFTITSAKMTDAGKYVCKLTNPHGEAKLTVTLVVKEKPK
EEPEATQPKLKKPQPEEKKPEVVESKVDIEIYELLKDEEPKNYEKVLRKHGIIDFKIIRK
HVEMVKTKKVEEEERHRVEVELQDKTDIEKIHQVSLEIQMPEKKKPMTTEEQEEEEIFEL
LKNVEPVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETA
ITIDGVKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEQEEIFELL
KNVEPVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAI
TIDGVKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEEEEIFELLK
NVEPVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAIT
IDGVKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEQEEIFELLKN
VEPVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITI
DGVKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTREEEEQEEIFELLKNV
EPVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITID
GVKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEQEEIFELLKNVE
PVEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDG
VKPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTREEEEQEEIFELLKNVEP
VEYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGV
KPEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEQEEIFELLKNVEPV
EYEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVK
PEEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEEEEIFELLKNVEPVE
YEKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKP
EEVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEEEEIFELLKNVEPVEY
EKVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPE
EVSPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEEEEIFELLKNVEPVEYE
KVLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEE
VSPTEITLQIAPTKPEEQMPTEVSLEIQMPEKKKPMTKEEEEEEEIFELLKNVEPVEYEK
VLRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEV
SPTEITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEKEEEIFELLKNVEPVEYEKV
LRKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVS
PTEITLQIAPTKPEEQMPTEVSLEIQMPTKKKPMTKEEEEQEEIFELLKNVEPVEYEKVL
RKKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDSVKPEEVSP
TEITLQIAPTKPEEQMPTEVSLEIQMPEKKKPMTKEIEEQEEIFELLKNVEPVEYEKVLR
KKGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDSVKPEEVSPT
EITLQIAPTKPEEQMPTEVSLEIQMPKKKKPMTKEEEEQEEIFELLKNVEPVEYEKVLRK
KGIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTE
ITLQIAPTKPEEQMPTEVSLEIQMPEKKKPMTKEEEEEEEIFELLKNVEPVEYEKVLRKK
GIIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETTITIDGVKPEEVSPTEI
TLQIAPTKPEEQMPTEVPLEIQMPKKKKPMTKEEEEEEEIFELLKNVEPVEYEKVLRKKG
IIQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTEIT
LQIAPTKPEEQMPTEVSLEIQMPEKKKPMTKEEEEEEEIFELLKNVEPVEYEKVLRKKGI
IQYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTEITL
QIAPTKPEEQMPTEVSLEIQMPKKKKPMTKDEEEQEEIFELLKNVEPVEYEKVLRKKGII
QYKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETSITIDGVKPEEVSPTEITLQ
IAPTKPEEQMPTEVSLEIQMPEKKKPMTKEEEEEEEIFELLKNVEPVEYEKVLRKKGIIQ
YKVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTEITLQI
APTIPEEQMPTEVFLEIQMPKKKKPMTKEEEEQEEIFELLKNVEPVEYEKVLRKKGIIQY
KVIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTEITLQIA
PTKPEEQMPTEVSLEIQMPKKKKPMTTEEQEEEEIFELLKNVEPVEYEKVLRKKGIIQYT
VIRQHIETVTKRIAEEAVLAEMEQVTVQPTEVVSEETAITIDGVKPEEVSPTEITLQIAP
TKPEEQMPTEVSLEIQMPEKKKPMTKDEEEQEEIFELLKNVEPVEYEKVLRKKGIIQYKL
IRQHINFVERRKQEEAVEPVDSVDTVVKPSDDKPEIQHAIFKLKKEKLPAEMEVSLEITT
DREPISDIAETTEVEVTSTELDAIIIKPAEGVQQEMVLTIQPSQIEEAAPTEIEIQIAPK
KPEEEKKPEKKKPLTKEEKESEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTT
RKAEEATLQEFEITLEKPIEAAPEEMVITIEPSKLEEAAPTEVKFQIAPKKREEKEEKVE
IKIMKKKPKQEEETVEVKVPEKKKPLTEEEKEAEVVFELLKDVQPEQYEKVLRKKGIIQT
KVIRKHIEMVTTRKAEEATLEEFEVTLEKPTETAPQEMVTTTEPSKLEEAAPTEIEIQIA
PKKPEEQKKPEKKKPLTKEEKESEEVFELLKHVQPEQYEKVLRKKGIIQTKVIRKHIEMV
TTRKAEEATLQEFEITLEKPTEAAPEEMVITIEPSKIEEAAPTEVEIQIAPKKPEEQKKP
EKKKPLTKEEKESEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEATL
QEFEVTLEKPTEAAPEEMVITIEPSKLEEAAPTEVEIQIAPKKSEEKVEKVEVKIMKKKP
KQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIE
MVTTRKAEEATLQEFEITLEKPTEAAPEEMVITIEPSKIEEAAPTEVEIQIAPKKPEEQK
KPEKKKPLTKEEKESEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEA
TLQEFEVTLEKPTEAAPEEMVITIEPSKLEEAAPIEVEIQIAPKKSEEKVEKVEVKIMKK
KPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKH
IEMVTTRKAEEATLQEFEVTLEKPTEAAPEEMVITIEPSKLDEAAPTEVEIQIAPEKPEE
KEEKVEVKIMKKKPKQEEETVEFKVPEKPEEKEEKVEVKIMKKKPKQEEETVEVKVPEKK
KPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEATLEEF
EVTLEKPTEAAPEEMVITIEPSKLEEAAPTEVEIQIAPEKPEEKEEKVEVKIMKKKPKQE
EETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVT
TRKAEEATLQDFEVTLEKPTEAAPEEMVITIEPSKLEEAAPTEVEIQIAPEKPEEKEEKV
EVKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQ
TKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEAAPEEMVITIEPSKLEEAAPTEVEIQI
APEKPEEKEEKVEVKIMKKKPKQEEETAEFKVPEKPEEKEEKVEVKIMKKKPKQEEETVE
VKVPEKEKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQAKVIRKHIELVTTRKAE
EATLQEFEVTLDKPSEAAPEEMVITIEPSKLEEAAPTEVEIKIAPEKPEEKEEKVEVKIM
KKKPKQEEETAEFKVPEKPEEKEEKVEVKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEA
EEVFELLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEA
APEEMVITIEPSKLEEAAPTEVEIQIAPEKPEEKEEKVEVKIMKKKPKQEEETAEFKVPE
KPEEKEEKVEVKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEK
VLRKKGIIQTKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEAAPEEMVITIEPSKLEEA
APTEVEIQIAPEKPEEKEEKVEVKIMKKKPKQEEETVEVKVPEKKKPLSKEEKEAEEVFE
LLKDVQPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEAAPEEM
VITIEPSKLEEAAPTEVEIQIAPEKPEEKEEKVEVKIMKKKPKQEEETAEFKVPEKPEEK
EEKVEVKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKK
GIIQTKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEAAPEEMVITIEPSKLEEAAPTEV
EIQIAPEKPEEKEEKVEVKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDV
QPEQYEKVLRKKGIIQTKVIRKHIEMVTTRKAEEATLQEFEVTLEKPTEAAPEEMVITIE
PSKLDEAAPTEVEIKIAPEKPEEKEEKVEVKIMKKKPKQEEETAEFKVPEKPEEKEEKVE
VKIMKKKPKQEEETVEVKVPEKKKPLTKEEKEAEEVFELLKDVQPEQYEKVLRKKGIIQT
KVIRKHIEMVTTRKAEEATLQEFEVTLDKPTEAAPEEMVITIEPSKLEEAAPTEVEIKIG
PDKPEEKEEKVEVKIMKKKPKQEEETAEFKVPEKPEEKEEKVEVKIMKKKPKQEEETVEA
KVPEKKKPLTKEEKEAEEVFELLKDVEPERYEKVLRKKGIIQTKVIRKHIEMVTTRKAEE
ATLEEFEVTLEKPTEAAPEETVFTLEPSKVDETAPTEVDFQIAHEKPEEHEEKVEIKIMK
KKPEETEDVVEVKVPKKKKPLTKEEKEAEEIFELLKDVEPKNYEKVLRKKGIIQMKIIRK
HIEAVEKHKAEETVKQLATQEVEAEVTLRVSEEVPSEVVEAAVIKPVEAAPVEAAPVKAV
PEKKLKPEEWKFTEELKPAKGFKGDTCELVCEVNDENAIVEWVKHGKVLKPSDKYELKED
GTKRILVIKDAVPVDGARYTCQLPKTKTGASLDVQIPVKIVGDLKPLTITERETAVLTCE
VSNTKAAVTWLKDGEPIDITLDKYEVLDEGRRKKLRIKNISPEDAAEYTCQLPRSSSTMT
LTVNEKPLEVLSPLTKLFAYLTGNATFECEVSEPWAKVTWLKGDKEVVPSDKYKMESDGR
FRRMIIQGIAEDDVSDYTCVLRDKKTSADLLLRETIKITKPPEDEDSRERQSVKFVCELT
GDAAKADVKWKKGGQVVRKDKRHKIINEGLVSTLVIEDLSPSDAGKYSVLVDNMEMPFTL
SVQALKPPVFTTKPKAVDTQEGMSAIFRYVIAGYPVPEIKFTKDWKEITPENSDVTFQFD
EATQEHKVIFHEVTPKDAGKYLVIAKNESGEVKQAVSMMVTPRPPEELMKRKMSLKARAS
QQEIFEDEEIDIEEILRDVKPKDYETVLKQHGIFDFRAILKQLQAMKKRAVQPEDLETLM
EEPEIPEQLESLELAAFEMAESPKVMGRGKPEETDLTPLADAKVPEKIAATFECDVSRDV
KDEDIVWMKDGQKITPDEKFQVKRDGRRLSLSIQDTSPEDSGQYTIKIGDKTQTADLKVQ
AAEFVKPLNNTSAAEYDETIVLECELSNELVPCQWYKDDVLITVGPKVEVIDDGKKRKLV
LHDVRPEDTGNFRCVVGDKESSATLDVKASEIMKPLAEVTAPEFAETAVLECEVSHPKAE
ATWLKDGQPITPEELTSKKYEVVSDGRKRRLIIHDVVKDDNAEFTCKVGDNQTVANVNVK
VPSITKPLEDTTTAFETTVVLECEVDNEKAPVKWMKNGKEITKMPKYLMESKGKKRRLTI
FETIPEDEGDYTCVVGDESTVAVLAVEPAPIEFLSEIQSVQAVEDEPAVFTCEISDDNAE
VIWLKNEEEIKPDDEKYEFVVSGKKRGLKIKSTDVSDTAEFTCKTKDKTSSASLTVTEHI
PTISHTLKDVKIEEGSNEVVFECETDVETADVAWLHKGKDIVEDNSKFVIKRKGRRHSLI
VKDVSVEDAGEFTCRIGVHETIAELIVEEKPVEFLAPLPKEQSAIPGDEITFEVELTKDT
EDVFWLKDGQKIKPGDNVKIVKDGKKHKLIIKKVDFDDDAVYSFNAGDQKCDCNLNVSAP
PKINVDPKLTNISVKAGTKIAIEATVTGSPAAVTTWSKGDTPIESTKRFKIEAGKGPKAS
IRLTIDKTERSDLGTYTLTAANDLGTDTAIIFIIVLDKPQPPTSLSITETTPESVTLVWT
APEDDGGSPVIEYVIEKRDMKRNTWTKVDTTSELTCRVPKLVEGNEYLFRVSATNELGTS
EPFTTSEPVTAKYQFDVPHAPSKPETSDVIQTEMTLTWTPPDFNGGSEVTGYIIERKEAD
KTRWVKITKETVTELTFRVKDLIEGTSYEFRVYAINKAGTSKPSEPSTPTKAKAPYDVPG
PPAQPTCENVNKTTITVSWTPPEDDGGSPVTGYVIERCDVSRGRWVKCNRDKVTELTFTV
SDLTDGGQYQFRISAENAAGVGQPSPTSATFTAKLPFDAPGAPGKPQVTEYNITKMTITW
TPPESDGGSPVTGFVVERKEKTSSRWVRVTKETVTETTLTVTGLTEGSEYQFRVIAENLA
GPGPASEPSDLQKAKLPFDVPTAPGKPDITSADKTEMELTWTIPESDGGSPITGYTIEKK
EKTGKWTKAIKTVVTETTTTVTKLIEKKEYQFRVAAINLAGTGPFSEPSDNKMAKAPYDV
PGPPSKPTTENINKTTITITWTPPENDGGSPVTGYIVEKCEGARGRWVKCNKDLVTELTL
TISDLHEGNDYQFRVSAENAAGVGQPGPPSDTVKAKLPFDAPGAPGKPQVTEYNITKMTI
TWSPPESDGGSPVTGFVVERKESTSSRWVRVTKETVTETTLIVTGLTEGSEYQFRVIAEN
LAGPGPASEPSDLQKAKLPFDAPSAPGKPEVTSADKTQMELTWAVPDSDGGSPITGYIIQ
KKENTGKWTQSLKTTTTDTTATIKSLIEKKEYEFRVAAVNLAGTGPFSEPSDYQIAKAPY
DVPGPPGKPTILEVDSTSMTITWTPPETDGGSPVTGYVVEKRDRVSSRWTKVKETSIEEV
VYTIIDLKEGNDYQFRVSAENKAGVGKPSEPSDQRRAKPPYDVPGPPGIPDISDVDKNRM
TLTWTPPTDDGGAKILGYIVEKCDADRKRWTKAHKEDLVTELTLTVYDLTEGTNYMFRVS
AENAAGVGESSPATQPKKAKPPYDEPGPPPPPTPTHVDRTSIHLTWSPPDDDGGSEVTGY
ILEKRDKARNKWTKVNKEPVPEISFTVTGLTEDAIYDFRVSAVNKAGEGPPSLPSDTLKA
KLPFDVPGAPSTPVPSDITETSVHLEWSPPSNNGGAEITEYIVEQKDRFSSRWTKAGETP
GDTVTITLKDLKEGNEYQFRVIAVNPAGPGSPSDACKPFVAKPPYDVPDAPGKPAPSDLS
PTSVTLTWTPPPSDGGSPITGYTVEMKDKFSTRWTKATRELISETTVVLPDLKEKEEYQF
RVIAENKAGQSKPSPELHVTAKYPFETPQAPTIDNVTRESPTSATMKWSPPKSDGGSEIT
GYVLEKKEKMSPRWSPVIESETETSFTVKGLPDGENVEFRVSAVNKAGTGKPSQVATLSA
KPPGAPDAPEVSDIDRTSATVTWTVPSSDGGSTITGYTIERREKGRDRWTRVNKSLVKDT
TLKVNDLTEKNQYEFRVIAENKVGPGEPSNPSARFTAKAPFDEPEAPYSLAASDITPTSA
TLSWLPPDSDGGSPILGYTLETKDRFSSRWTKVNKGLLQETSFKVTNLEENNEYVYRVIA
ENKAGPSKPSNECKFIAKHQFETPEAPGNVVAKDTTPTSTVITWREPSFDGGSPITGYTV
EMKEPYSTRWTPANKEPIEETTFLVKRLKENENYQFRVVAHNLAGPGKPSQSVNVTAKYP
FEAPKPPTPPEVKRLSPTSVQLNWSAPTSDGGSEVTAYIVEKKDKSGRWTPVTSDSIEDT
SFTVKGLKEGEDVEFRVSAVNKAGTGKPSEVTVIAAKPPSAPSKPEVTDIQKTSAVVTWT
APKNDGGSQVTGYTVEKREKGRDQWVRVNRKPVTETTMKVPDLVEKNNYEFRVIAENRAG
PGEASDASASFTAKAPFDEPSAPGVPKASNITPTSVTLSWTAPDSDGGSPITEYILESKD
KYSSKFSPVTRDTVTDLTFTVKNLKENGEYQFRVIAQNKAGPSEPSRETKVVAKYEFEVP
QAPSAPEVRRLSPTSIQLDWTPPFADGGSDITGYIIEKKEKSGRWTPVSSDSVDGTTFTV
KGLPDDEDVEFRISAVNKAGQSKPSQVTVLTAKPPGAPGRPEVSDINKTSATVTWKPSSS
DGGSTITGYIVEKREKGRDRWVPVNRKPINAVTMKVTDLTEKTDYEFRVIAENRIGQGQP
SEPSAKFIAKSPFDVPTAPGAPKASDITPTSLTLTWTPPTDDGGSPITNFIIEWKDKFST
RFTIFKKDLFVELTFKVTGLKDKTEYTFRIIAENKEGQSEPSKETVVVAKYGFDIPQEPS
APEVKRLSPTSVELSWTPPRSDGGADITGYILEKKDKSGRWTPVTDSVDGTSFTVKGLKE
GENVEFRVSAVNKAGQSKPSEVSLVAVKPPGPPGMPEVSDVDKNCVTLNWTPPTSDGGST
IIGYTVEKREKGRSWIRVNRTLVNETTMTVSDLVEKNDYEFRVIAENKVGPGEPSNPSIK
FVAKAPFDVPAAPDAPEPSNVTPTTATLTWTPPKRDGGSPITGYILEMKDRFATRWTQVN
TDSMTEVTCTLKTLKEGTEYQFRVIAVNKAGQSKPSAETVVIAKHPFDVPDAPTIDDVSR
ISETSAKIKWTPPSNDGGAEISGYIIEKKDRLAVKWSPVIEDTLDNTSFTVKNLREGEDV
EFRVSAVNKAGTGKPSSIATLAAKPPGPPGVPEASNIDKISATLTWTPPESDGGSKVTGY
IVEKRERGLDRWMKVNRAPVKDVTLKVLDLTEKKHYEFRVTAENKAGLGEPSDSVSFIAK
PPYDVPGAPSTPVASDISPTSATLSWSPPYSDGGSPITSYTIEMKDRFSSRWTKAKDMVT
EETFQLNSLKENNEYQFRVIAENKAGPGEPSPTVNVTAKYEFDTPQAPAEPDVRRTSPTS
VELSWVKPKSDGGSKIKGYIIEKKVKGEPWTQVTTDTVDGTSFTVRGLPEDEDVEFRISA
VNKAGAGSPSNTVVIAFKPPGPPGTPEVSDVDKTSVTLTWTPPKLDGGSKVIGYIVEKRE
KGRDRWVRINRSPVREVTMSITDLVEKNEYEFRVIAENKVGPGEPSSPSERIVAKAPYEV
PSPPKSLKATDLTPISVTLNWSAPLSNGGSPIVGYTIEMKDKFSTRWTNVSEHMVTTLSL
NVPNLKEKNDYQFRVIAHNKAGPGQPSEPISVTAKFPFNAPEAPSPPSIERISPTSVKLA
WSPPNSDGGDKVTGYIIEKKDRFSGRWTPVTKDIIDDTNFTIKGLKEGEEAEFRVVAVNK
AGSGKPSQTTVLAALPPGPPESPSISDVKQTSVTLSWTPPESDGGSKIIGYIVEKKDMGR
WVKVNRSPVRETTMVVTDLVEKSEYEFRVMAENKVGVGEPSAPSSRVVAKLPFDVPDKPD
QPDVTDIDKNEMTVKWSSPYSDGGSKITGYIVEMKEPYSSRWSQVTKTTDFTFKVTRLTE
GKDYQFRIIAENKAGQSQPSEPSRTFTAKLPFGVPGAPDTPELTDIKDFSLTVKWLAPTS
DGGSPILGYFVEQKDQFSTRWQRVKSSPILDLKFTVTNVQDDAECEFHVIAINKAGEGKP
SPSVSLTFRLPGPPGTPEVYNPSDKSVDLRWTPPTEQGGTRIIGYFIEKCEVGKDNWVRI
NRSSIREANYVVGDLTLNCRFKFRVCAENRAGVGPPSDYSESVLIKLPYDVPESPDTPKI
SDVTNDSMVISWQPPYSDGGSKVTEYIIEKKEPYSSKWVPVTKTRDLSYKITGLKENGDY
EFRVAAVNKAGASEFSVPTPSTKAKLPYDVPSQPHSLKIADVSPTSLTLEWSEPDSDGGD
NVSGYIIEKKDRFSPRWTPVNQTAISDTKFKVTGLKDGQDCEFRVVAKNKAGASQPSSVA
TFSIKPPDAPSRPDIKKVTENSVTLSWSPPESDGGSPVTSYIVERREPDRDYWVKATRYP
ITDTTFTVQDLTPKHKYEFRVIAENKAGLGGASEASKSVIAKPPYDVPDVPVDLDVTNIT
KNSAELFWNPPMDDGGSPITNYVVEMKDKFGVRWTSLGKPTKTSFKVTNLKTGSEYEFQV
RAENKAGEGEPIQSTKPIVAKDAYDVPDAPEKPEPSSLTETSVTLTWSPPASDGGSQITG
YIVEKKEDFMTRWVNATRDAIHKTTLTLNDLREGSEYTFRVIAENKAGQSKPSEPCRPFK
AKKPYGVPDTPGSPEASNITETSATLNWKAPTSDGGSPITNYEIEKREGASGRWTTCNRF
DVSETSFTVRDLRAGHEYSFRVAAVNKAGSGKPSVPSETFKAQPPYAAPEAPSAPVIEEV
TANSVKLSWEPPRLDGGSHIIDYVVEKKDAFSIRWTEVNRTPETTFTVPKLKEGDAVQFR
VTAVNKAGPGKPSQSSVTVTLKPEFTVPEAPSQPTAVEVDAVSITVRWSAPKNDGGSRIT
NYILEMKEQFSSFWKRVSTKESSELTYQVTGLKENQTLEFRVIAVNKAGEGKPSSVGGPF
TTKATYTVPSAPGAPDVSNVKATSMAVTWTKSISDGGSPITGYVLEKCDVSTGRWVPVNR
VPLRETSLVVDQLREKSEYCFRVVAHNVAGESKPSEPSKAYIAKPPYGLPDAPAKPDITN
IDAKQITLAWSPPWSDGGSPIIGYQIEKKDRYSVRWTRATRETIHDMQYTLRELTEGGEV
EFRVAAENKAGVGPFSDTTGTVIAKSPFDVPSAPGTPKISDITGTSLVLTWTPPSSDGGT
EITNFIIELRDRYGRWTRVNRTQVLKTGFNVMNLSEGDSYEFRVTAENKMGVGKPSDSTQ
KVTAKPPYSQPAAPNEPQISNVTADSATLTWSPPRDDGGSSITGYFIEKKDKFSPRWTRV
NHDAVTDTKFTVPALVPGEEYQFRVVAQNKAGASKPSEPTESTLVRSPFNEPGAPGAPET
SNVTETTLTLTWTPPFSDGGSRITGYYVEKKDRMSLRWSPVNFESTEDTKLKVTGLTEGT
EYEFRVVAENDAGRSKPSAPSYPVKAKSPFDLPSAPGTPSISDISSTNMTLRWAPPESDG
GTVIITFIVERREQFSTRWVQISRFDFTETTFSVTGLKDGNDYEFRVAAKNKIGIGKFSE
PTRPTKAKEPYDVPESPSTPDVSNITGESMTLNWTAPRTDGGSPITGYVIEKREPGRSGW
TVVNRSPITSLSCVVPNLRQGAEYEFRVIAENKAGLGRPSQVTHPFTAKPLTVTTPGIPD
QPEVEDVTATTITISWSPPSYDGGSKITGYTIESKSDATMRWVKIESTVPDTTYTAARLK
ELSEYQFRVAAINKAGRGDFSKPSRPVTCKPPYDPPPPPDAPDVYNITPTSAALTWSTPR
QDGGSPITGYVIDKKDKYSTRWVKADEVPAGTTDFTIKGLQAGNDYEFRVSAVNAAGVGK
PSAPCERFTAKAQYGVPDAPSPPSVSDITPSSMTLSWEPPASDGGSTVTGYIVEKRECPV
GRWVPVNRAPVKETTFKVNDLSEDRKYEFRVSAENAAGVGKPSEVSLPRVAKSPYDAPSA
PGRPTATNVDSTELVLEWTAPVADGGSAITNYVIEARDKFGLRWSKINRQTVTDTTFKVT
GLKPNDEYQFRVIAENKVGLGRPSDNTEPIVAKPPYDTPDAPESVQVTGTTASSASLEWS
PPFSDGGSPVTGYFVERKDQYSARWTRVNRVPVTETNMVVGDLKEGLQYQFRVCAENRAG
IGRSSDSTKPTVIKDPVDAPSAPLEPTIASITADSATLTWTAPTRDGGSAVTGYIVERKD
PYTARWTPIERCTDTNCKISGLKEGNEYQFRVLATNKAGQSAPSNPSQPKVAKSPYDVPE
APSKPQVAEVKATSVTLKWRPPGSDGGSPVTGYVVQKKERLALRWTPVNTTPVGDTIFTV
TGLTQKSEYEFRVVAANKKGFGQPSEPTNSVLVKPPYDIPGRPSPPVVTDFTKTSVTLQW
NPPESDGGSHITGYVLEKKEAYSVRWFPCTSQSILKPEFTVKDLKEGAQYEFRVMALNKA
GLGPPSDGSELATAKSKFGVPSPPGEPTISNITAKSVTLNWTAPSSDGGSPVTGYTVERA
DRFSTRWVPVNSHPIKDTKMDIHDLPATGSYQFRIVACNAAGTSKPTNPTDSIGMAVAPK
LDTYKYHDTMVVRVGATFNLDVPFKATPKPTVKWTKDGSTLQASSRIKIDTTDRDTIVTI
KNCVREDEGSFKLDVSNTAGSDAITIRVQVLDRPEQPRGPLVAKDIGSTDLFLSWKEPAD
NGGSPITHYIIERREEDRTSWTRLTTRALDTTVRVTSLQEGASYVFRVFAVNKIGDSEPL
ETKETIKLKKKYDVPEAPSKPLVTNVTSDSVTLEWHSPKSDGGAPISGYIIEKKETSSNY
WSKVTTVSSGVTSHRIPRLMRGEEYEFRVSAENRAGPGPASTPSAPIRAEDTTVLPKFSG
RFDEPIMAKVGESFRIEVPYTGIPTPAVTWSFDGRPLKPSAHIRIDTSNRASTITVKNVE
KANGGRYTINLKNTAGAESLDVEVRVFDRPGPPRGPLEMSNVSESTVTLSWSPPSDDGGS
RIFTYVVQKRGEIETKWKHVNKDYIIDLTYKVTGLKENKKYQFRVLAENQYGQSKPLEGQ
SITPQGQYNVPDPPSAPKVTNIIGDSVTVGWTPPSNDGGAPVTGYVVEMRQTTSPRWIKA
TLTPTPDTTFRASRLIRGTEYEFRVCAVNRAGTGRPGEPSNTVMVEDPAVKPKFNLDARF
EKVITIRAGHTFRIDIPYKATPTPTVSWTQNGDTVQKSNRITIDSNNYGTTLTARTAERT
DSGDYVIRASNKAGEDTVTVTVNVVDSPSPPQGPLALVKLGSNEVTLSWSRPRDDGGSPI
TGYVLEKREGGYGSWTNVSSKIPDTTFRVTKLTEDREYQFRVRAENNLGVSEPLESERII
PKGDYDVPDQPGKIKVDTIQSDSVSLTWSRPQRDGGAPVTGYIVEKRERGQPEAGWNRTS
YKPVMDTTIRVPRLSEGKEYEFRVSAVNKAGMSTPAATAAPVIVERPSYAPKIDLGSQFR
DVITVRAGTLFHLDVPISGTPTPTVAWLMDEKQVDDGRRIKASTTTYSAVLTNKDARRTD
SGTYTIKISNKAGTDTATIRVAVLDKPSAPEGPIKVTSITCDSVTLAWEPPKDDGGADIT
GYILERREPDQFRWTRVTSTLSSPRYAVTGLKDGRSYLFRVRAVSKYGESEPLETEDAIL
IKSAFEKPPAPGVPKASNVRDDSITLSWQPPHSDGGAEIHNYILEIKETRGTRWLRATRK
QLKSPNFRVTGLSKGREYEFRVAAENEAGLGAFSKTSAPIVSKTPIELAEFVEPLKDVSA
KAGKIVTLECRISNPNAEVKWMKDGFQIFGYDRVNEIKEGQRRAITLRNVGDRDTGKYSC
ECGKQSTSCWLSVTAPPTIDVKAYKDVVVVKTGNTLRLLVPYTGCPSPKVEWHRHDARIS
EDTRTHIETRDNRTQITIRNVVRGDTGKFSITLTNEAGQETAIIRVNVIDVPGPPTGPLE
ITDVGRHCVSLSWEPPKDDGGSPIQSYTVEQREANRRMWTSVSNYVSHVPFTVSGLSEKV
EYEFRVCAENINGVGPPLHGIEPVVIVAPYSVPTPPGKPEISNVQRDRMTLTWSEPSHDG
GKPIQGYIIERRENFSKQWNRVNRDLIKDTTFTIKGLTEGSNYEFRISAVNDTGIGNPSE
VSAPPKLARSPAGRPTPPGAPIIGDITATSVSLSWSAPSTDGGSEITHYIVERRLKGSYM
WIDRTVVHDTSCSVNNLVEDKEYTFRVTAVNAAGNESDPSRASESFVAESQLPGAAPSIL
IEIQNAMVAEGQTGMFMCKISGAPKPKVSWMHHGRELMPGRKHNITEDNGVFKIVVFSVT
DYETGMYTIIAKNKHGSVRSSAELLIQRPPQLSIDRHLQDLSVRAGQEIHIPVTLTYGTP
KPTFTWRRHDGEELDTRGRYSTKEQGRVHDFELPDLGGNRYPLSGFYTLKTEKLLRESGC
GTTWANNNLLSSKKLRVNVVGGIAELYVKDAEREDSGTYTLEAVNELGRHSITARVNVLD
RPGPPQGPISIQSITNNSATFTWTPPLDDGGAPIQRYQVSIRESNRTHWQPLGTSLLPNF
TAKKLKDNTHYVLRVTAENQYGTSRPLEIREAILVKSPFDPPSAPGRPTISNIQRDSVHV
SWTAPSSDGGSSITGYIIERRDTTSQRWIKANHEPVTTTSHTLINLREDTEYEFRVMAEN
SMGASEPSTVSQRVLVRDPIDTVPPQFVSKPQNAHVAEGKSVTVTCQVSGYPAPEVRWYR
LGREIAHGRKFQIGGDGNIHTLTANQLFPEDVGEISVTVTNKGGTITDAFELNVLVMPKL
TLPARLRTPIHLLLGEYIMLKVPFSGTPRPSIKWDRDGEDVVDGGRFEIKATPHDTTLII
RGITKEDAGKYSVVASNELGHDTCSIQVNILRHPDSPRNLECLEITSEAIRLAWNPPIYD
GGSNISSYMVEKREVGVLTWARVISSKNTHHTVINLRSDTQYQFRVTAFNMYGASEPCEA
TAVICTKSSKAGRPQFEDYEGKRRFYDSLVDYDRGPHPFVNREGSIYDYYQILEELGRGS
YGIVYRAIEKKTQKTWAAKFMRCFGKERDLVRREIEVMKKLHHRRLLNLHEVFETNEEII
MILEFLSGGELFDRLVDENHILTEPEVIFYMKQTCEGVKHMHERHLVHLDLKPENIMLCA
RNSDDIKIIDFGLTMELDPDKPVKIMFGTPDFIAPEVVNHEPIGLPTDMWALGVIAYLML
SGISPFEGETDRETLKNVATGEWDFDEEAFADISDEGLDWIERILIKGKEGRMTIQEALD
HPWLQMETDEMARRRARRLDNSRLRKYRDKNAPKGAGRTVNAIGHLAHGGALREMHKMYR
GKPLMERECYMDVRDAAPKFIKPLENTMAIEGNAGRFECEVSALSEPLITWFRGKQELII
SIKYKMLYDDHKYTLIVQDSEFDDIDEYTCKAVNSYGHATSSASLDVQLLDAKELDSRGE
RRGLDMKRKKIPLGERAKKLRKAQAEAPSSDKAPQLIRPLEDQECGFSFIMPLSFQVAEI
PGMPEPKVKWYHEDRPLKPGAHYHFYEEDGVHTLEIDGTTEKDKGQYTAEISNQYGSIAT
KCRLDVNELFLTKFKDYRKPHFDLHLRDIFIVEGSAARLDCKVTGVPEPNIRWFKDHKEI
FDGQHYSIEFGEDDETCSLIIQEAFLQDAGTYTCLASNLLGRISCDSYVRVERLGVDSEG
GSARSILHVKQLYKRKFYRESSEDERVVSRSKIEPVRSGSRVQLPFFSLPLRRKTVYDGE
PARISCNVQGTPKPKISWSKNGVPIYDGTFYNITYRWGVAMVEIRHASKSDTGTFRCTAK
NAEGEATSACELVVEQRVPRSETEDYIRPSFAKPLRRIRAKEGRKVRLEIQVMGWPEPKV
TWLKDNVDVVHSDHMYVEKFPNGLQSLVIYRVVPTDAGRYQAIASSPAGKATCSADVDVI
PGEALPDRGGDVGRGRHKTRKAPRSPRSYLDVATESTRPHQKRSKHLRDPSSLSPTYNYE
SKRTQRKDYYTPRTDVLAPSRSRSFSPTSPTGLSPSSRYSPSRPHTPSTYRPSSPMGTYR
PSSPTYRSPSPAYRPASPTYRPSSPYHSYATSKRLSSRQGVEDSGVDYYQARSDRPSQYA
EMKESRRTTRDSGPGFLDVTRTSATFTRSGGRPLPKLTSYTAWYDNMRGNRDRPSTPTTT
DRTRYTEPYRPAYTEPYRPVVRDRPVAGPTRIPRRVYRSEEEDYYSARQVTSPYKLDDRY
SREYGGYEVSDDEFTMRTYAPSASGVAADDEEPEYAAPEEPEQAGPPSFDKKFQDMSIRD
GERVVLEVVITGSRPMDVGWLRNGQDIVDCKEFRYVSRGNIYQLEIAEIFPEDSGKYTCE
ALNDHGESECSAMITVNEEPSVSISISQSMDVDVSLSTDMPCTATMDEDHIPPEFFEEPQ
SQMVEEGTTAVFTCDVDGDPVPSLTWSKDGRPFTDGGRFSIRSDKFTHTLEIQNARSTDA
GVYACTARNSEGEVVCEFTLDILPTGADDKGITASDVSSAAARDSAESAKSSSAPSAEPS
ASTAPQGSAGKGPKDGESTTGVSGSDTDSQEGGPPKFLRGLQEEYAWEEDEVVLECHVQG
VPMPTVKWFVHNKEIESDKFVVITMDNDGVSRLTISEAFAEDSGVYRCEATNSSGTASTS
GELMVAGKVVVPKAPGGKPKVEQASKTSFKITWAAPAEDGGSPIFNYKVDGRKAKETGWT
EVANVTQTSFEVTGIVPGVEYVYRVSAENEAGWSPSTAISDRAVITESESPPKTSSSTDK
PPVVKDSPPNKDQAGKGPGPKPSAAPPPPPKRGGGALANRMAKFSK
NT seq 72141 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattaagcgaccttcctgttccagagcaagtgccttatgtacatgaaccacag
ttgaagccagctggcaggaaacctgtggaaactcctgtgtcctttgagggtctgaagaaa
atccccaagagagagagccctcctatattatatgaggcaccattatttccagaggaagtt
gttcaagaacaaaggtcactggtcgaaccattagagagaatgccccgaccacaaccacca
gctcaggttaaagaatcgccaattccatctagagaggtacagcctgaagtttacatacct
tttgatcagttggaaaaaactaaaatcaaggaggatcaaataactccacagcagctcaga
ccatcaccacaagcaagttttgaatcattttcgaaattgcccaaaccccaaattccagaa
tatccagagtttgaagaagaggtaccgtttgatgctcaaccagagcagcaatatccagta
tcatttcctgagagaaaacccaaaccagaagttgctgttaaacctcgtgctaagcaacca
acacatccaggaagaccacaggtgatggaggaattacaagatactgaggctactgtagga
gaagaaactcaattgcatacaatcatcataggtctaccaagaccaaggatccagtggctt
agaaatggacgtcccattgatggagaccgctttgagacaatcgtccaagaagatggaaca
tgcatacttgtgataaagattgtactggaggaagatcaaacagtctatgaatgtagagcc
actaatccattggggacagtgtcttcttttggaaatttgacagtgactacacaggagacc
accacaagaagaacagtaacagaaactgtcacaacagagatttatactactgacagtgaa
caagagcagtactatcctcatagaacacaaatagaaattggtcctggtcatgacaggcga
accttcatcccaccaaggcagccacgacctgtcagttcatctatagagatatctccagag
gatagaacagagacaatgaccacaactactgttacagaaaccatcacaagatatgacgat
gacactttgtctgatatcacaacccagaggtcagaatatgacatgtatcctgaatacgaa
cggccctcacaagaaattgagttgataatagatggtgtccgaccccaccctcaaagacaa
actgcaactgttcaaggaagaccaaggggaccagagatccgtgagaggaccacaattgac
attgataggcgagctcctcttgcacctgttgagttcataatcgacacaagggaagatcag
ccacaagaagagtatgagactattacaagaaggaagaagacaactgttgtcacaagaagg
gataatgaagaagatcaggaacccatagaaaaatactccattgaatatcctcaggagcca
aggagaccagtcgatttctcatttgacctgccaactccaagttcagttgattactcggaa
gaagaaattttgccaagatacattgaaccactcaagatagatgtagacatcccagaaaca
tatgaaatttgtcgtggtgtggaggatgtacagcagccaactccaatcgaagtgcaattt
gagcaagagcctgtggaagaaataacactagggcctgaggagatattgccagtaagacgt
gaaagacatgagccaattgagcttacattttctcagacaccagttgaggagattgatctt
ggatctgaaaaagtactaccccgtaaagagccaaagcctattgaattgacctttgaagga
gcagaagtagaggaaatttcgctaggtcctgaggaagtgcttccgaaagttaaacctaag
ccccagaagcctattgaaatgaaatttgatcatgctcctgtggaggaaatcacactaggc
cctgaaagggttccatctaaaccatacaagaagcctgaaccttttcaaatggagtacgaa
tgtccttccgtccaagatatccagcttagagaggaacaggtgatgccaaaacccaaacgt
caaccaattgagctgacctttgctcacaaatccacagaggagatatatcctggggaagaa
gtgacagcacctcaacctgaaattccactgcagcctgaatttgaagaattggttatacca
tctgaatatgctccagatatacctaccaagcaaaagacattcgtgaagcagacaattgtg
caagaagttcatccacagccaaccaagaaactaccgactcctgaagagagaggcaggagt
gtccttgaattagaaactcggcctcaacctcgtgagatcgaactcattctagatcttaac
caacctgacgatgtcactagaacttacacagagactgtgactactgaaacaaccaccgtc
actgagcatgaagaacaaccaaacgttgaatatgaagaattgattattccaggagagcct
gaaaggccaagaaaaccaacacagaaagctcaaaagaagcaaacagagccaatatatgtt
gaggaatctgacctgttgccagaagagtctattcctggacattctcctttatctcctgaa
gatctcccatttgcacgtgcagctgtcaccaggatacctccagaagtcatgacagctcct
gatgatgttgaagtttcatatggagatacagccaggttagaatgtcaaatcacgggagaa
ccacaaccacttgcccgttggaacagggatggaacaccagtgacaggtaatagataccta
acacttgttgagagggatgggcgtgttgttcttgtaattaacccagttgaagaagttgat
gacacagagtttgagtgtgttgctactaatgcagagggaactgtgtcaacatatgctgat
gtatatgttcaggatatccctacagagaaggtgaaaagccgcacagaaaaacgtccaaag
aggactgaaaaggtgtctgtttctgtgaaacccaagagaagagaaactgctgaaattgaa
attgatcatgaggaagaccgcccacttaagtcattcgaggtaaccgttgatgttcctaaa
ccactctctccagaagatgttcaacaacgaccccgtggcccagctgacgttccagttcag
ccaatgcaaagattcaaacctgacaaaccagaatttgaagttcttgtaatcccaaagcaa
cctgaggaagaagaagaaagtattactatatcagagagtgtcacaacggttgtcgaaact
aaagaggttgttgctccacgtgagacaacacaaattttaatcgatcagaaacaacgacct
cttgctcctatagaattaacacttgatgtgcctaaggaggaagagccagagtatgaggtg
ctagttgtacctgaagtacccgaggaggagtctgttacaactgtaacagaaactgtaact
acagttgttgaaactgaagaatatcctgataaacgtgagacaacaaaagtacaaatggaa
actcaaaggacgccacttgcacctgtagaacttacttttgaggctcccaggcacgagcaa
ccagaatatgaagaaatcgtctttccagctgagaagcctcatgaacagcctgaatatgaa
gtctgtgtcattccccaggaaagacagccggaagaagagactgtcacaactgttgaagag
attgttacaactgttgttgagacacaagagattccagagacacatgaaaccacacaagtg
ttactcgaaaagaagaaaaaacctcttgctcctatggagttgactttcgatattcccaaa
gaagaaaagcctgaatatgaagtcctcgtcattcctcaggaaagacagccggaagaagaa
actgtcactactgttgaagagattgttacaactgttgttgagacacaagagataccagag
acgcgtgaaaccacacaagtgttactggagaaagggaaaaaaccacttgcaccagtggag
ttgactttcgatattcccagagaagaaaagcctgaatatgaagtcctcgtcattcctcag
gaaagacagccggaagaagaaactgtcacaactgttgaagagattgttacaactgttgtt
gagacacaagagataccagagacgcgtgaaaccacacaagtgttactggagaaagggaaa
aaaccacttgcaccagtggagttgactttcgatattcccagagaagaaaagcctgaatat
gaagtcctcgtcattcctcaggaaagacagccggaagaagaaactgtcactactgttgaa
gagattgttacaactgttgttgagacacaagagataccagagacgcgtgaaaccacacaa
gtgttactggagaaagggaaaaaaccacttgcaccagtggagttgactttcgatattccc
aaagaagaaaagcctgaatatgaagtcctcgtcattcctcaggaaagacagccggaagaa
gaaactgtcactactgttgaagaaattgtgacaactgttgttgagacacaagagatacca
gagacgcgtgaaaccacacaagtgttactggagaaagggaaaaaaccacttgcaccagtg
gagttgactttcgatattcccaaagaagaaaagcctgaatatgaagtcctcgtcattcct
caggaaagacagccggaagaagaaactgtcactactgttgaagaaattgtgacaactgtt
gttgagacacaagagataccagagacacgtgaaaccacacaagtgttactggagaaaggg
aaaaaaccacttgcaccagtggagttgactttcgatattcccaaagaagaaaagcccgaa
tatgaagtcctcgtcattcctcaggaaagacagccggaagaagaaactgtcactactgtt
gaagagattgttacaactgttgttgagacacaagagataccagagacacgtgaaaccaca
caagtgttactggagaaagggaaaaaaccacttgcaccagtggagttgactttcgatatt
cccaaagaagaaaagcccgaatatgaagtcctcgtcattcctcaggaaagacagccggaa
gaagaaactgtcactactgttgaagagattgttacaactgttgttgagacacaagagata
ccagagacgcgtgaaaccacacaagtgttactggagaaagggaaaaaaccacttgcacca
gtggagttgactttcgatattcccaaagaagaaaagcccgaatatgaagtcctcgtcatt
cctcaggaaagacagccggaagaagaaactgtcactactgttgaagagatttttacaact
gttgttgagacacaagagataccagagacgcgtgaaaccacacaagtgttactggagaaa
gggaaaaaaccacttgcaccagtggagttgactttcgatattcccaaagaagaaaagcct
gaatatgaagtcctcgtcattcctcaggaaagacagccggaagaagaaactgtcactact
gttgaagagatttttacaactgttgttgagacacaagagataccagagacgcgtgaaacc
acacaagtgttactggagaaagggaaaaaaccacttgcaccagtggagttgacttttgag
gtcccaagaactgagcatccagagttcgaggaagaagtgccccaacaaccagaatatgaa
gtggttgtcatgcctatggaacaagaaccagaaatggaaaccatcactactgttacagaa
actgtaacaactgttgttgaaacagaagaccagccagactcaagacaaacaacacaaatt
gaaattgaccaacaaaggcaaccacttgctcctattgaactaactcttgagattccaaaa
gatgaaaaaccagaatatgaagtattagtgatgcctacggagcaaccagaagaacaaccc
gaatatgaaattcttgttcaaccaatggagcaaccaatagatgaagaagtcactactgtc
tctgagactgttacaactataactgaagtagtcagaactgaagaggttcccgatgccatt
gagactactaaggttattattgatcaaggtgaacagcctctagctcctgtagaacttact
tttgagattccagaggaagaaaaaccaagaattgaagatgttcctgtgcagcaagaatat
gaggttttagttatgccaatggaagaggaggaaaaaacaatgactacagtagttacagaa
acggtgacaacagtcatagaaacagaggaaatacctgaagtcaaagagaccagtgagatg
tttattgaccagaaacagcctcttggtcaagtggaattaacacttgaattgtctccaggt
gaacagccagaaattggagttgtgcagccatttacagaagaaactgtggaaactctttct
gaagatgttccagacagagtagaagctgttccgcaagaggaggcaggtgtacaagttgtt
gtcacacaagaaccaccccaggttatcagacctcttgaagatattgtcacagatgttggt
gagactgtgcgcttaacatcgcaaatagtaggtcatcctcagcctgacatccagtggctt
aaacatggcaaacctgtcacaggagagagatttgtaaccctgattgaaagagacggcaat
actgtcctactaatttcaccagtcaagaaggaggatgaaacagattttgagtgcattggt
attaatgaggaaggaacagtttcaacaagagctgaaatatacctgggtccaaagaaacca
cgtgataagcctactgaaaagcctgtaaagaaaccagaaccacagaagaaaaagccagtt
gagcagcttcctatcactgaagaggttccgatcccacaaaaagtagagcaggagcaacca
agagggcctgtggacttaccagaaaagcctaaacatcctatcactgaagaggttccaatg
ccacaaaaagtcaagcaggagcgtccaagagggcctgcagacttaccagaagagcctgaa
tatgaagaagttgttgccatcagtgaagaaatggtctctgctgagatcctattaatggct
ggtgaagagccagaatatgaggaggaaattgtgatgccagaagaggaagtgactgaaatt
gaaataactactcgtgaagttactgatgtagttattgagaagaaacctgagggtgttcag
atcgaatttgagttgcctcaagaaaaaccagaagaaacctcttcaacaaccgtcacacag
actgtaactatgactatagaacaagaagacaaaggcccgcagagagctgaggtcgtgatc
gaccaagagcaacagcccttgcagccgatcgaactcgtattagatgtaagggaagaagaa
atgccacagatgccagagtatgaggaactagtcatacctagtgaggaaatgccagaaaaa
acagagagaactgaaatagtgattgacaaagaggaggatgagcaaaggccaatcgaaatt
gtctttgaggctccccagcagacacaggtaacagaagaagtctcaaccactgtgacagaa
acaatatcagaagttgttgaaacgagaaaagacttcgcccctaaaccaactgaggttgtg
atggaaattgaggttccacgtgaacctgaggaaccaagagaaactactactgtgattatg
gaaaagggaccagaagaactgcaaggtgtagagttcattcttgatatctccgaagaacca
gagaaacctaatgacaaaacattcattgagatcattcgccatgtcactgatatcgaggtg
gagattggcaatcgagctcacttcacttgctttatattgggaaacccaaggcccactttc
cagtggtctgccaatggaaggccactccaaggtgaccggttcatctccatcttcaattta
gatggaatctgtgagctgatcatcactgaggtacaggaggaagatgagactgtgtatgtg
tgccgtgctgagaatcctgccggcgttgtcaccactgaggcagaacttattattcctggt
acagaaggccctcaggagtttgcaccagttgaaattaccctggagaagtctccagaatcc
tttgaggagatcaccacaaagaaaaccactacgattaccaccaagatcactgaaatacca
gaggatatcgaagtgcagatcaaagacactgccaccaagataaccgaggagatcatccgc
caagtgaccacggagcacaagcagggtccagtagtggtccaggagctggtgtctcaggag
gcgtctccgggtgggatcgtttacctggagtgcaggttcacaggcaccccacagccaacc
ttcaagtggtaccataatggggagggcctcaagggggagaggtatgtggtgattaactac
aatgatggggtgagtcagctctgcattactgaggttaccaaagacgatcatggtaccttt
gtgtgtgaggctactaacccactcggtaatgccacgactgttgccgagatccgtgtctac
ggtaccgacgagctacccaaaccaggagagaaggctgaaataattctgcaagttgaacaa
gaagctccaaaggacatcgagatcatcatatctcctccagagtttgtccagccaatcgtt
gacattgaagttgccgagggtgatgatgtgagattcaaggcccaggtcactgggtcacag
ccaatcactatcacatggtaccaagaaacaaagcccatacaggaatctcccgagttcaag
gttgcatttgatggcaagacatgtacccttgaggtacctgaggtcttacctgaagatgct
gggaagtatacctgcaaggcagccaatcccgcaggagaagtcaccagtactgcagttctt
actgtcaaagataagggaccacaaagaatgccccttgatgaatcaatgaggaaagacttg
acatatccgttagagcagagtataccttctttaagcccataccaacatggtgattacaca
agctcatccagtgatgctgagtcagttaaagagccaacagataaatttggcatagatgaa
atattggaaaatgctgttcctgggtttatatcagaggaagaggaagatgatgagaacaaa
acaaatggtcctaatagactgcaacctgaaaaaggtgatggtttacggatggatacagga
ttgagcccaggcacatcagatgtagaagattctgacaaagaatcaacaacatcaggcgaa
tatgacatggcatctccatccgtgctcacccatgaatactttcacattgatccaaaacct
ggcaaccagagccttgccccaatcattgaagacacagagcaaaacaataataatgagatt
caaacaagctctgaccttgagaacaacaaagaaaataaaccagtcccattagaagagaat
atggtaaaggaaactctgaaaccaacagagaaagcttttcgtccatcctttgaagatctt
gagcacagtcagctaaaatcagaagatgaagctgagcaaaaagaaccaccagaacacgca
tctaaatcaccagatagtaaaaccagcacagacgaagtagaacacatagatgccacatct
gattctgtatccaaattatcagatagttataccagcacagatgaagcagaaagttccaga
gatggcagtgatgatgatacaagtttgcctgagagaaatggccaagaacagactgtatta
gagggactatctactgcaaccgggaatctgttgcttgatgtaatctctacagaaggccag
cattcttcttgtgacgaggactacgaggatgaggaagatgatgtcttcttggaagaaaaa
aggaaggcatccatacaacaagattcagaagacgatgaagagaatgactacattgagttg
tctcacaaagactctgttgttgaaagtgattatgagcttctcctttcgactggaagcctc
tcttgtgaaccagagaagaaagagaagaagtcgtcctcatccagtgatgatgatgactac
acagacctagtgaaggaagtagtgactggaccatcccctaccaaagcaatagcatattct
gaatttctccaacaagcaaagaagatgctggaagaggacgaatcacatgaagacacacaa
tcagaatcagacatcaagagcgatgtgcagaaaacagatgggaatacttccccgtcggct
ctcagccccaaagaagattggcaatctttcactctctcactggaagctaaacacaaactg
ggtgtggttcagattaccagaaaagaagaggttgtagtgtatgagcaggttcttgaatgg
cgggaacctcgcaaaagttctgatattgtacttccaaatcaagcagacattccaaagttg
agagatgaggaaaatgacaagataccagactatcagaagtatgagacaccggaggaagag
aagaaaagtgaatatgtagaagacacctttgtccatccagtatctccacgtagaactttg
ccagatctttcatcttcagatgatgaatccattcagtatgctgaaatcttaccaaacagt
ttactgccaagaaaatctcttaatgttgctttgtctagcaaaggacaagaagatggatca
gaaggtcaatcaaaagactcaggtgatggatcttcctccgatgaatctattaaagtagag
caggggaatatagactcaattgcacttcagttcacagagaaacaaagaattaagtctcaa
tcttcttcagaatcggatggatcaacactagacagatctgatgaggatgaggatgatgat
tatgatgatgatcatgatcattcaggcaaagaattggaggaggaagccataagtccaagg
aatgattttacagtggaggcatcactaccaagagaagcaagacagacacaagattcaagt
agtacagatgagagagaggaacctggtagccctcattctgacttaaagccagcagatcta
tttctttctgaaattgttattcctgtagatggagcgcctcttgaaaaatcatttgtgttt
catttgagagaccatgaatatggaatagatgaaggagaacctgaggacagtgatctggac
atcagtgaaggtcaagagtcaagtatctccttagcagagagagttgtagtaatagatctg
ggctcagatctcgaacacctttctcctacactgcatcagagtgatgatgacacaactgca
gaagaatgtagccttggagtggtatctgtggcagacacactgtaccaaactgttgaactc
tctattcctatccccaaaagagatcatagtgaagatacagatgatgatgaagattgggaa
gacattcctcgatataaaacaagtgtggaattaccttcgccctccaacgaagagtatttt
ctacctatcgaagtgacaccaagcaaagttcaatccatccacagttacctagaatggacc
gaaccaagggaacctttgcattcaccagtttcttcagaaagtaaaagtttcactgagagt
gacctagagcaagttctagatgaatgtgtatctacttctgatcaacttgacaccgagtct
gaaaaggaaccagtgatgtttgaggaatttctttcattacggcgagaggaatacactttt
tcaatgcccccaaaagtaatgcagagcgttgatctggaaattaatgtacatgatgttatg
agtgatggtgatcattcaaaagacaccgatacagagaaagaaactgtcgaaagtgataat
gaagaaaataatcaggctgcaacacaatttaaagaatctgatccaactgaaatgttcgtc
tctgcagatgactttcctgtagaggaaatgtcagttttaggtgaacaatcgagtagttca
agtggttcttcatctcctgttatgcttgaactgaagatgccttcaagccaccctgatcct
gacaatccagaaacaaactttgtcaaagtcagagtgcaggaaagccaagaatctctaaca
ccagcagaaccactagatgaatcttcccccaaaatggaagatacaatctcccttactccc
tcacaattacctgacactatgtccaagcctgatgctgcccccaaatctcaacttttcact
aaaacccctgagacaaattgtcctggcgctttggaagacaattctaagcaggacttaaaa
caggaatcctcaagtgcaggtgaaagtgtttttgatagccagcctgatggtgatgatgca
cccttgcatgctgatgatgatcttgtagactctgtacttcttgacaagtcatctcctcag
agcccaggaagccaggaatttctaaccccacaaaaaccactggatggatcttcccccaaa
atggaaaatacgtccaagcctgattacaccccccaatctcaacctatcactgaaacccct
gagacaagttgtcctacagatttggaacataatcctaagcaggacttaacacaggaatcc
tcaagtataggtggaaattcttttgatagccagcctgatggtgatgacgcacccttgcat
gctgatgatgatcttgtagactctgtacttcttgacaagtcatctcctcagagccaagag
agccagaaatctctaacaccagcgaaaccactggatgaatcttcccccaaaatggaagat
tcaatatcccttactccctcacaattacccgtcactatgtccaagccggattctgcgccc
caatctcaacttatcactgaaacccctgagacaagttgtcctggtgaattggaagacaat
cctaagcaggacttaaaacaggaatcctcaagtataggtggaaattcttttgatagccag
cctgatggtgatgactcacccttgcatgctgctgatgatctggtagactctgtacctctt
gacaggagccaggaatctctaacaccagcgaaactactggatgaatcttcccccaaaatg
gaagatacaatctcccttactcccaaaatggaagatacaatctcccttactccctcacaa
atacccgtcactatgtccaagcctgattttgatggtgacgatgcaagttgtcctggtgct
ttggaagacaatcctaagcaggacttcacacaggaatcctcaagtataggtggaaattct
tttgatagccagcctgatagtgatgactcacccttgcatgctgctgatgatcttgtagac
tctgtacttcttgacaggagccaggaatctctaacaccagtgaaaccactggatgaatct
tccccaaaaatggaagatacaatctcccttactccctcacaattacctgtcactatgtcc
aagcctgattctgccccccaatcgcaacttatcactgaaatccctgagacaagttgtcct
ggggctttggaacacattcctaagccagacttaaaaaaggaaccctcaagtataggtgga
aatgtttttgatagccagtctgatggtgacgatgcacccttgcatgctgtcgatgatctt
gtagactctgtacttcctgaagaacaggagttgcatggttgtttgtcaaaagctttccca
tcgtcaccgggagagaagggagatgaagagaaaccggtggaggatgtatccagacccagg
gaggagaagaaaccagaaaccaagcagctcaaaccggaggttgaggagaagactgaaaac
ctcacccaggagatcttggttgagaagacaccaaaggaaatcatggcagaggagctagag
gcagccgcaagaggtgaacagccagaactgatgcctcccaagttcatcaaacccatcgaa
acggtcgtcgccggtgatggcgatgcagtcaagtttactgccacgctgactggcaagcca
cgccctgatgtcacatggtacgtcgatgacacccagatcaaggacgaacccgagtacgag
gtcgctttcaccgatgacggcaccgcttcattgaccttgccggaagtcatccctgaagat
gaggggatgtacctctgcaaagctgtcaatgtggttggacaagctacttgcagtgcagag
ctatttgttgaagaatctaagccgactgaagacaaacccatcactttggaaagacacact
gagactcgtgggaaatccacggtgagcatggagatagatgatactcgtgagccccggaag
attgaacttgagttcaagaagccggaggatcaggagatatctatcaccatggtagcgccg
cagtttacccaaacgattgtctcggtgatcatcaaggatggacagccagccacgttcagg
gcggtagtcaccggcaagccaacaccggatatcctgtggttcaggagcggtgcagagatt
gtcccggaagagtgtccggagttcaccatcacctttgataccggtggggtgtgcaccctg
acccttgaggaagccttccctgaggactctggtccatttgagtgcagggccatcaaccca
gctggtcaggccacctgcatggccaagctggttgtcgtagaggagagttctaccgaggta
gacacggaggttgagattgctacatctcaaaaggtcatcactgtgacgaaagaggtcgag
cagacgacagtcattaaagaagaggagattcaagaagagatgccaattgctgaagtgaaa
attgaaggccttgaatctgtcatggtgattgaacctactgaacctgagacattcatcgcc
atcggtaactacctcgctgaatctgacgaagtgatgtccatgcgtgagggtgagcagctc
actatcctggacgatgggcatggtgagtggtggatggcccgccgtgagaggactggtgag
gagggatgggtgcccaagggttacctagcaaccgctgaccagtatgacgagcatctccgc
cagcagctggaagaagtggtgaaggagatgtccattgatgagcttatgcctccttctgat
gcagaaacaccattcaagggcatggccatcgccccagagatcatcgagcctctacagaca
accaaagtcaaagatggaaaaccagtcaccctccggtgccgcatcaagggcacaccgatg
cccaccttggcttggttccgtcagagcacccagatcccagcgacggaggagttcaagata
gctaccgacggcgacatcgccacgctgaccatcgaggaagtctaccccgaggattctggg
aagtatacctgcgttgccaagaaccaggccggtacatcatcgaccagtgccgagctgctt
gttgaagttgctctttctgatgcagagagtgatggaacaccaagccgcaagagtctatca
agggagtcaaccattgaagaaggtgaaggaatcaaacctgccttcatgacggtcgccaag
agccaggtggtcagcgccggcagggagaaagtcacttttgagttccgcctcattgccgca
cccagacctcagatccaatggttcaaagacgaccaaccgctagaggagacgccacgtcgt
cgcatgagcatgtacgccgatgtccatctgtacattctgaccctggaactgaccgacatt
gagccggacgatgaagggaagtaccgtatcgtagcaaccaacaaggagggcaaggcaatg
gcatctgtatctctggaggttacacaagtagacaacacctctgttcccgtcacaggtttt
gtagtgtcgatgtcgtcacccatgtcgacccccgctggcgaccgtgggggctggcacgta
cacaagattcgtacttggtccggctcccccatcaccatctccatcccttcctttatgcat
gcctgcaaccgcccctctgacttttgcatgcacaatgatgccatatatccgacaatgcac
gaagatgatgatgaaaactcatcagaagttgaccatattgattcagggaaagaacccgag
ccgccaaagttcattgaacccatccaaacggcaacggtcacccagggcgacatggcccgg
ttcgagtgcgtagtgactgggcgccccatgcccgagatcacttggttccacggcgagaag
atgatcaagccatccgatctgatcgagattggtcaggacaaagaagggaggaattgggtg
gtggtccgcaaggccacgcccgaaatcctaggtaccttcacttgctgggctgagaatcag
gtcggacgcaccatgtgtggtgccgagctgactctaatgtctgaaccagaagagagctcc
attgtctctgtcgacagtagcgccattgtcgagggtccacagagccgtgacctagtcagc
gtcgacttcgaaggtgtggacgacctcgatgaagaaggtgttcctccatcttttgtcatg
cctgtccaggatgtggaggttaaaccaggagaaactgctcatttgagagtcaaagtcgct
ggcaaacctactccagaagtcacctggtaccgtgatggcaaggttcttcagcctagccct
cgccacaccatcatgtccgacaccgaaggcaacgcgtctcttgtcatctcagagaccatg
cccggtgacgatgctgattacctctgcaaggctgtcaatccgtttggcatcgtatcttgc
cgtgctgatgtcattgtagatgaagaaccatctgaagtgaagaaggaaaagccagccatc
ttggtccaggcagaagcccaaccccagggccctgtagaggttaccctagaggtccggggc
aaggatctagagattgctagcatcagtgaggctccctctatcacctctgaggaggccttt
gaaacagatgtggaggagaaggagttggatgaggctgaaggtgctgagcctgaaggctgg
ttccaagatgacgtccagattgagatccaactagaggaccttgggaaacaccccgaggag
gtgatcatggaagtcactaagaagatggaggagaaatctgtgaggcaagaggttgtgatg
caagtcgaggtcacacctaccagggaggaggtcaccctagctcccacagaggtgcctgaa
cagaaagctccagtcttcacacagccattgacgacagcggaactcaagaaaggcgagacg
accgagatcacctgcaaggttgagggtcaacccagaccagaggtccagtggtttgtggac
gataaagccatcgagccggacactcactaccagaccgaacacaggccggacggagtgtgt
gtgctgaccatccacgatgtggagagtatggacgagggtcagtacgtggtccgagcaatc
aatccagttggagtcgcctctacggagtctgaactgtttgtggaagtaccaggcaagatg
gctccagtgaaggttgaagctaaggccaccctggaggttgagaaacctcttgagacaatt
tccaagcaggaagcagccgttgttgaggaacaagtcgtaccaatggacaagaaaccaaca
gaagctgcaccagaggtcatgcctcagttccaattagagcccactcaaagagaaatcgct
gaagtgtatgaagcacctaagtttgttgaggacatggtggacttggaaatcatcaagggc
catcctgccaggttcgatgtccaggtcagcggcatccccatgcctatactgcactggtat
cgcaatggcaaagagatcaagccagatgaccagcatgtgaagttcgagttcgcagaggat
gaaggaatcggttccttgatcatcgatgaagtcagggctaatgacgatgcagaatatgcc
tgcaaggcttcgaacaaagcaggatccgctgtgtctaaagcagatctgttcctccaggca
gctcacaaaaagcgaccggagaagcacccaccaaaattcatcatcgatatgaaatcactt
acagcagtagagggcgatagcatcaacttcttctgcaaagtcgtgggcagacctatgcca
gagattaagtggtacaagaatggtgtggagcttaaacttggacctcgcatttctatcgat
tacgatgagcagggaatgtgcactctcctcatccgcaacaccaccatggaagacgttgct
accttcacgtgcaaggctgtaaacgagatcggcgaggcaacgacaacggcagaactgatc
ttggaagtccctgcccgaatcacggacggtcccaagaatgtgtcggtcaaacgcggtgac
tctgtcaccgttgacatccacattgttgggttccctcagcctgccgttacttggtacaaa
aactctgtcgtcgtggaagccaccgaaagaatcaccaaggaaacgacacgagaaacgtcc
cagctggtcatctctaaggccacaatggaagacgctggcaactatgtggtggttgtcgag
aacgagctggctcgagatgaactccaaatcagcattacagtcatagacataccagccaaa
ccccagaagctggaacccacccaggtgacaccaacctccaccaccatcacatggcagacc
ccagtgatggaggaggaaggccaagaggtgtcctcctacgttgttgagatgctagacagc
gccaccaagtcatggcagaggatagccgagaccctcaaggcaccggtcttcaccatcgct
gacctgacgcctggtgaggaatacgccttcagagtcagtgcctccaaccagtttggtgtc
ggtgagcccaccgagaaggtgtcggttcatcttccaatggaaaaggagcttgaagatgca
cccagggaggtggcagaggacacgctgaccctacaaaccaaggccatgattccagaagag
accactcaagctgctgaagaggtagcaacagttgaagctgtggaggttggcaagacagaa
gttccaactgagaaagccctacctgaagaatttcctgaagtgaccgtcgaaattcctgca
gcagatgcacctgaggtgcctgaattacttcctgaggaagcaaaaccggacaaggcagag
aagcgccctcagaatatcccaccagctgctgaggttccagtggaagctcccatacctgaa
gataaccctgatgatgaagacaggcctgaagaagaacctatctcggttaccatcgatgaa
ggtccttctgaaagtgcacaatttgattccgacgatgatgatgatgatgaagaggaagaa
gaacttacagaggaagatctagaagaagagccaatagtggaaccagaattgcctcatgac
gaaggcaaagagcctgagcctgagcctgagaagaaagagaaaaagaaaaagaaaaagaag
aagaagaaggataaggaacctaaattgaaagtacaggtgcgagaactggagcagcctgat
gtggaatataaaagacgtgtcttccttgacacagtggaggaagaggacgaagaagtaaag
tctcccaagggtagggctagagccatccttaggaagaagaagcctattatagatgaaact
gcagtcatcgatgtcgagaaggcgccccaggctccaaaggatcaggaagcaactattcta
gtgaccaagaagccaacagaagttgctctctcggctcaagaagctccagaagacatcact
gatatcggtatctctgcaatcacacccgactccaaagatgttcttgttgaaaaggccgtt
cctgacgagaaacctgttgtaaccattgcagaagccaaaccacaagttacggagccaagg
gaaactgcggagattgtccttcctatagatgtacaatctgaaaaggccgaggcagtcctc
agagttggcaaaccacaggaagcagaagagatgcaggaaatgcacatagaggtgggagtt
gagaaggtgaaacctgaggaggctgttaccctggagatgccattggagaaggcagaagtt
agagaagcagcccctgtcattgtggacaaattgaaagaccagacggtaaagacaggagct
cctatcctacttacatgcaaagtagctggtgaacctgtaccggacgttgagtggtataag
gaaggcaagttactggagcccacaccgacacagacacagacttatgcagctggggttgcc
actcttgaaatcctacaagccaagcccgctgaccagggcaaatatgaatgcatggcggtc
agtgacgtcggagaggacacctcatctgcccaagtgaccgtcaagattgagaaacccaag
ccaaccaagccatccttttcggagactaccatcacgattgaagtgacagagggcgaggat
gcgaccttcaagttcacaatcgagggattcccttgcccgaccctgacctggaataaaggt
tggaaagccgttaaacccagtgcccagtacatcattgaatcagatgaaacctccggagag
acaatcttcaccatcacatccgccaagatgaccgatgctggcaagtacgtctgcaaactg
accaaccctcatggggaggcaaagctgaccgttaccctagtggtcaaggagaaacctaag
gaagagccggaagcgacacagcccaaacttaaaaaaccacaacctgaggagaaaaagccc
gaagtcgtcgaatccaaggtggatatcgaaatctacgagctactcaaggatgaggagccg
aagaactacgagaaggtccttcgaaagcacggcatcatcgacttcaagatcatccgcaag
catgttgagatggtgaagacaaagaaagttgaggaagaagagaggcatagagtcgaggtc
gagttgcaggacaaaactgatattgaaaagatacatcaagtctcccttgaaatccaaatg
cctgaaaagaagaaacctatgactacagaagaacaggaggaagaagaaatcttcgagctt
ctcaagaatgtagaacctgtggaatatgaaaaggttctacgcaaaaaaggcatcatccaa
tacaaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtc
ttggcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggca
ataaccattgatggtgtgaaaccggaagaagtttcaccaacagaaatcactctccaaatt
gctcccactaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcct
aaaaagaagaaacctatgactaaagaagaagaggagcaagaagaaatcttcgagcttctc
aagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatccaatac
aaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttg
gcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaata
accattgatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgct
cccactaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaa
aagaagaaacctatgactaaagaagaggaggaggaagaagaaatcttcgagcttctcaag
aatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatccaatacaag
gttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttggca
gagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaataacc
attgatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgctccc
actaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaaaag
aagaaacctatgactaaagaagaagaggagcaagaagaaatcttcgagcttctcaagaat
gtagaacctgtagaatatgaaaaggttctacgtaagaaaggcatcatccaatacaaggtt
attaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttggcagag
atggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaataaccatt
gatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgctcccact
aaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaaaagaag
aaacctatgactagagaagaagaggagcaagaagaaatcttcgagcttctcaagaatgta
gaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatccaatacaaggttatt
aggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttggcagagatg
gaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaataaccattgat
ggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgctcccactaaa
ccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaa
cctatgactaaagaagaagaggagcaagaagaaatcttcgagcttctcaagaatgtagaa
cctgtagaatatgaaaaggttctacgtaagaaaggcatcatccaatacaaggttattagg
caacacattgaaacggttacaaaacgcatagccgaagaggcagtcttggcagagatggaa
caagtaacagtacagccaaccgaggttgtatctgaagaaacggcaataaccattgatggt
gtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgctcccactaaaccg
gaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaacct
atgactagagaagaagaggagcaagaagaaatcttcgagcttctcaagaatgtagaacct
gtagaatatgaaaaggttctacgcaagaaaggcatcatccaatacaaggttattaggcaa
cacattgaaacggttacaaaacgcatagccgaagaggcagtcttggcagagatggaacaa
gtaacagtacagccaaccgaggttgtatctgaagaaacggcaataaccattgatggtgtg
aaaccggaagaagtttcaccaaccgaaatcactctccaaattgctcccactaaaccggag
gaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaacctatg
actaaagaagaagaggagcaagaagaaatcttcgagcttctcaagaatgtagaacctgta
gaatatgaaaaggttctacgcaagaaaggcatcatccaatacaaggttattaggcaacac
attgaaacggttacaaaacgcatagccgaagaggcagtcttggcagagatggaacaagta
acagtacagccaaccgaggttgtatctgaagaaacggcaataaccattgatggtgtgaaa
ccggaagaagtttcaccaaccgaaatcactctccaaattgctcccactaaaccggaggaa
caaatgcctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaacctatgact
aaagaagaggaggaggaagaagaaatcttcgagcttctcaagaatgtagaacctgtagaa
tatgaaaaggttctacgcaagaaaggcatcatccaatacaaggttattaggcaacacatt
gaaacggttacaaaacgcatagccgaagaggcagtcttggcagagatggagcaagtaaca
gtacagccaaccgaggttgtatctgaagaaacggcaataaccattgatggtgtgaaaccg
gaagaagtttcaccaaccgaaatcactctccaaattgctcccactaaaccggaggaacaa
atgcctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaacctatgactaaa
gaagaggaggaggaagaagaaatcttcgagcttctcaagaatgtagaacctgtagaatat
gaaaaggttctacgcaagaaaggcatcatccaatacaaggttattaggcaacacattgaa
acggttacgaaacgcatagccgaagaggcagtcttggcagagatggaacaagtaacagta
cagccaaccgaggttgtatctgaagaaacggcaataaccattgatggtgtgaaaccagaa
gaagtttcaccaaccgaaatcactctccaaattgctcccactaaaccggaggaacaaatg
cctactgaagtctcccttgaaatccaaatgcctaaaaagaagaaacctatgactaaagaa
gaggaggaggaagaagaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaa
aaggttctacgcaagaaaggcatcatccaatacaaggttattaggcaacacattgaaaca
gttacgaaacgcatagccgaagaggcagtcttggcagagatggaacaagtaacagtacag
ccaaccgaggttgtatctgaagaaacggcaataaccattgatggtgtgaaaccggaagaa
gtttcaccaaccgaaatcactctccaaattgctcccactaaaccggaggaacaaatgcct
actgaagtctcccttgaaatccaaatgcctgaaaagaagaaacctatgactaaagaagaa
gaggaggaagaagaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaaaag
gttctacgcaagaaaggcatcatccaatacaaggttattaggcaacacattgaaacggtt
acaaaacgcatagccgaagaggcagtcttggcagagatggaacaagtaacagtacagcca
accgaggttgtatctgaagaaacggcaataaccattgatggtgtgaaaccggaagaagtt
tcaccaaccgaaatcactctccaaattgctcccactaaaccggaggaacaaatgcctact
gaagtctcccttgaaatccaaatgcctaaaaagaagaaacctatgactaaagaagaggag
aaggaagaagaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggtt
ctacgcaagaaaggcatcatccaatacaaggttattaggcaacacattgaaacggttaca
aaacgcatagccgaagaggcagtcttggcagagatggaacaagtaacagtacagccaacc
gaggttgtatctgaagaaacggcaataaccattgatggtgtgaaaccggaagaagtttca
ccaaccgaaatcactctccaaattgctcccactaaaccggaggaacaaatgcctactgaa
gtctcccttgaaatccaaatgcctacaaagaagaaacctatgactaaagaagaagaggag
caagaagaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggttcta
cgcaagaaaggcatcatccaatacaaggttattaggcaacacattgaaacggttacaaaa
cgcatagccgaagaggcagtcttggcagagatggagcaagtaacagtacagccaaccgag
gttgtatctgaagaaacggcaataaccattgatagtgtgaaaccggaagaagtttcacca
accgaaatcactctccaaattgctcccactaaaccggaggaacaaatgcctactgaagtc
tcccttgaaatccaaatgcctgaaaagaagaaacctatgactaaagaaatagaggagcaa
gaagaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggttctacgc
aagaaaggcatcatccaatacaaggttattaggcaacacattgaaacggttacaaaacgc
atagccgaagaggcagtcttggcagagatggagcaagtaacagtacagccaaccgaggtt
gtatctgaagaaacggcaataaccattgatagtgtgaaaccggaagaagtttcaccaacc
gaaatcactctccaaattgctcccactaaaccggaggaacaaatgcctactgaagtctcc
cttgaaatccaaatgcctaaaaagaagaaacctatgactaaagaagaagaggagcaagaa
gaaatcttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaag
aaaggcatcatccaatacaaggttattaggcaacacattgaaacggttacgaaacgcata
gccgaagaggcagtcttggcagagatggaacaagtaacagtacagccaaccgaggtcgta
tctgaagaaacggcaataaccattgatggtgtgaaaccggaagaagtttcaccaaccgaa
atcactctccaaattgctcccactaaaccggaggaacaaatgcctactgaagtctccctt
gaaatccaaatgcctgaaaagaagaaacctatgactaaagaagaagaggaggaagaagaa
atcttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaa
ggcatcatccaatacaaggttattaggcaacacattgaaacggttacaaaacgcatagcc
gaagaggcagtcttggcagagatggagcaagtaacagtacagccaaccgaggttgtatct
gaagaaacgacaataaccattgatggtgtgaaaccggaagaagtttcaccaacagaaatc
actctccaaattgctcccactaaaccggaggaacaaatgcctactgaagtcccccttgaa
atccaaatgcctaaaaagaagaaacctatgactaaagaagaggaggaggaagaagaaatc
ttcgagcttctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggc
atcatccaatacaaggttattaggcaacacattgaaacagttacgaaacgcatagccgaa
gaggcagtcttggcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaa
gaaacggcaataaccattgatggtgtgaaaccggaagaagtttcaccaaccgaaatcact
ctccaaattgctcccactaaaccggaggaacaaatgcctactgaagtctcccttgaaatc
caaatgcctgaaaagaagaaacctatgactaaagaagaagaggaggaagaagaaatcttc
gagcttctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatc
atccaatacaaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagag
gcagtcttggcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaa
acggcaataaccattgatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctc
caaattgctcccactaaaccggaagaacaaatgcctactgaagtctcccttgaaatccaa
atgcctaaaaagaagaaacctatgactaaagatgaagaggagcaagaagaaatcttcgag
cttctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatc
caatacaaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggca
gtcttggcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacg
tcaataaccattgatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaa
attgctcccactaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatg
cctgaaaagaagaaacctatgactaaagaagaagaggaggaagaagaaatcttcgagctt
ctcaagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatccaa
tacaaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtc
ttggcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggca
ataaccattgatggtgtgaaaccggaagaagtttcaccaacagaaatcactctccaaatt
gctcccactataccggaagaacaaatgcctactgaagtcttccttgaaatccaaatgcct
aaaaagaagaaacctatgactaaagaagaagaggagcaagaagaaatcttcgagcttctc
aagaatgtagaacctgtagaatatgaaaaggttctacgcaagaaaggcatcatccaatac
aaggttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttg
gcagagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaata
accattgatggtgtaaaaccggaagaagtttcaccaaccgaaatcactctccaaattgct
cccactaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctaaa
aagaagaaacctatgactacagaagaacaggaggaagaagaaatcttcgagcttctcaag
aatgtagaacctgtggaatatgaaaaggttctacgcaagaaaggcatcatccaatacacg
gttattaggcaacacattgaaacggttacaaaacgcatagccgaagaggcagtcttggca
gagatggaacaagtaacagtacagccaaccgaggttgtatctgaagaaacggcaataacc
attgatggtgtgaaaccggaagaagtttcaccaaccgaaatcactctccaaattgctccc
actaaaccggaggaacaaatgcctactgaagtctcccttgaaatccaaatgcctgaaaag
aagaaacctatgactaaagatgaagaggagcaagaagaaatcttcgagcttctcaagaat
gtagaacctgtggaatatgaaaaggttctacgcaagaaaggcatcatccaatacaaactt
attaggcagcacattaactttgttgaaagacgtaagcaagaagaagctgtagaacctgta
gattctgtggacacagtcgtcaaaccctctgatgataaacctgagattcaacatgctatt
tttaaactgaagaaggaaaaactaccagcagagatggaagtctctcttgaaataacaact
gatcgggagccgatttcagacatagctgagacaaccgaagttgaagtgacgtctacagaa
ttggatgcaattattataaaacccgctgaaggtgtacagcaagagatggttcttacaatt
caaccaagccaaattgaagaggctgctccgacagaaattgaaatccagattgcccccaag
aaaccggaggaagaaaagaaaccagagaagaagaagcctctgaccaaagaagagaaagag
tctgaggaagtgtttgagcttctcaaagatgtacaacctgaacagtatgagaaggtgttg
aggaaaaaaggcataatccaaactaaagtcatcaggaaacacatcgaaatggttacaacg
cgtaaagctgaggaagcaactcttcaggagtttgaaattactctcgagaaaccaatcgaa
gctgcgccagaggaaatggttataacgattgaaccatccaaacttgaagaggcggctcca
accgaagttaaattccagattgctcctaagaaacgagaagaaaaggaagaaaaggtcgag
atcaagatcatgaaaaagaaaccaaagcaagaagaagagactgttgaagttaaggtaccc
gaaaagaaaaagcctctgaccgaggaagaaaaggaagcagaggtagtcttcgagcttctc
aaggatgtccaacctgaacagtatgagaaggtgttgaggaagaaaggtattattcaaact
aaagttatcaggaaacacatcgaaatggttacaacgcgtaaagctgaggaagcaactctt
gaggagttcgaagtgactctcgagaaacccaccgaaactgcaccacaggagatggttaca
actactgaaccttccaaacttgaagaggcggctcccaccgaaattgaaatccagattgct
cctaagaaaccggaggaacaaaagaaaccagagaagaagaagcctctcaccaaagaagag
aaagagtctgaggaagtgtttgagcttctcaaacatgtacaacctgaacagtatgagaag
gtgttgaggaagaaaggcataatccaaactaaagtcatcaggaaacacatcgagatggtt
acaacgcgtaaagctgaggaagcaactcttcaggagtttgaaattactctcgagaaaccc
accgaagctgcgccagaggaaatggttataacgattgaaccatcgaaaattgaagaggct
gctccaactgaagttgaaattcagattgcgcctaagaaaccggaggaacaaaagaaacca
gagaagaaaaagcctctgaccaaagaagagaaagagtctgaggaagtgtttgagcttctc
aaagatgtacaacctgaacagtatgagaaggtgttgaggaagaaaggcataatccaaact
aaagtcatcaggaaacacatcgagatggttacaacgcgtaaagctgaggaagcaactctt
caggagtttgaagttactctcgagaaacccaccgaagctgcgccagaggaaatggttata
acgattgaaccatccaaacttgaagaggcggctcctaccgaagttgaaatccagattgct
cctaagaaatcagaagaaaaagttgaaaaggtcgaggtcaaaatcatgaaaaagaaacca
aagcaagaagaagagactgttgaagttaaggtacccgaaaagaaaaagcctctgaccaag
gaagaaaaggaagcagaggaagttttcgagcttctcaaggatgtccaacctgaacagtat
gagaaggtgttgaggaagaaaggcataatccaaactaaagtcatcaggaaacacatcgag
atggttacaacgcgtaaagctgaggaagcaactcttcaggagtttgaaattactctcgag
aaacccaccgaagctgcgccagaggaaatggttataacgattgaaccatcgaaaattgaa
gaggctgctccaactgaagttgaaattcagattgcgcctaagaaaccggaggaacaaaag
aaaccagagaagaaaaagcctctgaccaaagaagagaaagagtctgaggaagtgtttgag
cttctcaaagatgtacaacctgaacagtatgagaaggtgttgaggaagaaaggcataatc
caaactaaagtcatcaggaaacacatcgagatggttacaacgcgtaaagctgaggaagca
actcttcaggagtttgaagttactctcgagaaacccaccgaagctgcgccagaggaaatg
gttataacgattgaaccatccaaacttgaagaggcggctcctatagaagttgaaatccag
attgctcctaagaaatcagaagaaaaggttgaaaaggtcgaggtcaaaatcatgaaaaag
aaaccaaagcaagaagaagagactgttgaagttaaggtacccgaaaagaaaaagcctctg
accaaggaagaaaaggaagcagaggaagttttcgagcttctcaaggatgtccaacctgaa
cagtatgagaaggtgttgaggaagaaaggcattattcaaactaaagtcatcaggaaacac
atcgaaatggttacaacgcgtaaagctgaggaagcaactcttcaggagtttgaagttact
ctcgagaaacccaccgaagctgcgccagaggagatggttataacaattgaaccatccaaa
cttgacgaggcggctccaaccgaagttgaaatccagattgctcctgagaaaccagaagaa
aaggaagaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagact
gttgaatttaaggtacccgagaaaccagaagaaaaggaagaaaaggtcgaggtcaagatc
atgaaaaagaaaccaaagcaagaagaagagactgttgaagttaaggtacccgaaaagaaa
aagcctctaaccaaggaagaaaaggaagcagaggaagtcttcgagcttctcaaagatgtc
caacctgaacagtatgagaaggtgttgaggaagaaaggcattattcaaactaaagtcatc
aggaaacacattgaaatggttacaacgcgtaaagctgaggaagcaactcttgaggagttc
gaagtgactctcgagaaacccaccgaagctgcgccagaggaaatggttataacaattgaa
ccatccaaacttgaagaggcggctccaaccgaagttgaaatccagatagctcctgagaaa
ccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaaccgaagcaagaa
gaagagactgttgaagttaaggtacccgaaaagaaaaagcctctgaccaaggaagaaaag
gaagcagaggaagtcttcgagcttctcaaagatgtccaacctgaacagtatgagaaggtg
ttgaggaagaaaggcattattcaaactaaagtcatcaggaaacacatcgaaatggttaca
acgcgtaaagctgaggaagcaactcttcaggatttcgaagtgactctcgagaaacccacc
gaagctgcgccagaggagatggttataacaattgaaccatccaaacttgaagaggcggct
ccaaccgaagttgaaatccagattgctcctgagaaaccagaagaaaaggaagaaaaggtc
gaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgtagaagttaaggta
cccgaaaagaaaaagcctctgaccaaggaagaaaaggaagcagaggaagtcttcgagctt
ctcaaagatgtccaacctgaacaatatgagaaggtgttgaggaagaaaggcattattcaa
actaaggtcatcaggaaacacatcgagatggttacaacgcgtaaagctgaggaagcaact
cttcaggagttcgaagtgactctcgagaaacccaccgaagctgcaccagaggagatggta
ataacaattgaaccatccaagcttgaggaggcggctccaaccgaagttgaaatccagatt
gctcctgagaaaccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaa
ccaaagcaagaagaagagactgctgaatttaaggtacccgagaaaccagaagaaaaggaa
gaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgttgaa
gttaaggtacccgaaaaggaaaagcctctgaccaaggaagaaaaggaagcagaggaagtc
ttcgagcttctcaaagatgtccaacccgaacagtatgagaaggtgttgaggaagaaaggc
attattcaagcaaaagtcatcaggaaacacatcgaattggttacaacgcgtaaagctgag
gaagcaactcttcaggagttcgaagtgactctcgacaaacccagcgaagctgcgccagag
gaaatggttataacaattgaaccatccaaacttgaagaggcggctccaaccgaagttgaa
atcaagattgctcctgagaaaccagaagaaaaggaagaaaaggtcgaggtcaagatcatg
aaaaagaaaccaaagcaagaagaagagactgctgaatttaaggtacccgagaaaccagaa
gaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagag
actgttgaagttaaggtaccagaaaagaaaaagcctctgaccaaggaagaaaaggaagca
gaggaagtcttcgagcttcttaaagatgtccaacctgaacagtatgagaaggtgttgagg
aagaaaggcattattcaaactaaagtcatcaggaaacacatcgaaatggttacaacgcgt
aaagctgaggaagcaactcttcaggagttcgaagtgactctcgagaaacccaccgaagct
gcgccagaggagatggttataacaattgaaccatccaagcttgaggaggcggctccaacc
gaagttgaaatccagattgctcctgagaaaccagaagaaaaggaagaaaaggtcgaggtc
aagatcatgaaaaagaaaccaaagcaagaagaagagactgctgaatttaaggtacccgag
aaaccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaa
gaagaagagactgttgaagtaaaggtacccgaaaagaaaaagcctttgaccaaagaagaa
aaggaagcagaggaagtcttcgagcttcttaaagatgtccaacctgaacagtatgagaag
gtgttgaggaagaaaggcattattcaaactaaagtcatcaggaaacacatcgaaatggtt
acaacgcgtaaagctgaggaagcaactcttcaggagttcgaagtgactctcgagaaaccc
accgaagctgcgccagaggaaatggttataacaattgaaccatccaagcttgaggaggcg
gctccaaccgaagttgaaatccagattgctcctgagaaaccagaagaaaaggaagaaaag
gtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgttgaagttaag
gtacccgaaaagaaaaagcctctgtccaaggaagaaaaggaagcagaggaagtcttcgag
cttcttaaagatgtccaacctgaacagtatgagaaggtgttgaggaagaaaggcattatt
caaactaaagtcatcaggaaacacatcgaaatggttacaacgcgtaaagctgaggaagca
actcttcaggagttcgaagtgactctcgagaaacccaccgaagctgcgccagaggagatg
gttataacaattgaaccatccaaacttgaggaggctgctccaaccgaagttgaaatccag
attgctcctgagaaaccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaag
aaaccaaagcaagaagaagagactgctgaatttaaggtacccgagaaaccagaagaaaag
gaagaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgtt
gaagtaaaggtacccgaaaagaaaaagcctttgaccaaagaagaaaaggaagcagaggaa
gtcttcgagcttcttaaagatgtccaacctgaacagtatgagaaggtgttgaggaagaaa
ggcattattcaaactaaagtcatcaggaaacacatcgaaatggttacaacgcgtaaagct
gaggaagcaactcttcaggagttcgaagtgactctcgagaaacccaccgaagctgcgcca
gaggagatggttataacaattgaaccatccaagcttgaggaggcggctccaaccgaagtt
gaaatccagattgctcctgagaaaccagaagaaaaggaagaaaaggtcgaggtcaagatc
atgaaaaagaaaccaaagcaagaagaagagactgttgaagttaaggtacccgaaaagaaa
aagcctctgaccaaggaagaaaaggaagcagaggaagtcttcgagcttctcaaagatgtc
caacctgaacagtatgagaaggtgttgaggaagaaaggcattattcaaactaaagtcatc
aggaaacacatcgaaatggttacaacgcgtaaagctgaggaagcaactcttcaggagttc
gaagtgactctcgagaaacccaccgaagctgcgccagaggagatggttataacaattgaa
ccatccaaacttgacgaggcggctccaaccgaagttgaaatcaagattgctcctgagaaa
ccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaa
gaagagactgctgaatttaaggtacccgagaaaccagaagaaaaggaagaaaaggtcgag
gtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgttgaagttaaggtaccc
gaaaagaaaaagcctctgaccaaggaagaaaaggaagcagaggaagtcttcgaacttctc
aaagatgtccaacctgaacagtatgagaaggtgttgaggaagaaaggcattattcaaact
aaagtcatcaggaaacacatcgaaatggttacaacgcgtaaagctgaggaagcaactctt
caggagttcgaagtgactctcgacaaacccaccgaagctgcgccagaggaaatggttata
acaattgaaccatccaaacttgaagaggcggctccaaccgaagttgaaatcaagattggt
cctgataaaccagaagaaaaggaagaaaaggtcgaggtcaagatcatgaaaaagaaacca
aagcaagaagaagagactgctgaatttaaggtacccgagaaaccagaagaaaaggaagaa
aaggtcgaggtcaagatcatgaaaaagaaaccaaagcaagaagaagagactgttgaagca
aaggtacccgaaaagaaaaagcctttgaccaaagaagagaaggaagcagaggaagtcttc
gagcttctcaaggatgtagaacccgagcgatatgagaaggtcttgaggaaaaagggcata
atccaaactaaagtcatcaggaaacacatcgaaatggttacaacgcgtaaagctgaggaa
gcaactcttgaggaatttgaagttactctcgagaaacccaccgaagctgctccagaggag
acggtcttcacactcgaaccatctaaagttgatgagacggctccaactgaagtcgatttc
cagatagctcatgagaaaccagaagaacatgaggaaaaggtcgagattaagattatgaag
aagaaacctgaagaaactgaagatgtcgttgaggtgaaggtacctaaaaagaaaaagcct
ctgaccaaggaagaaaaggaagcagaagaaatatttgaacttttgaaggatgtggaacct
aagaattatgaaaaggttttgaggaagaagggtatcatccaaatgaagattattcggaaa
catattgaggcagtagagaagcacaaagcagaggagactgtcaagcaactggcaactcag
gaggtggaagctgaagtcactcttagagtttctgaggaggttccttctgaagttgtcgaa
gcagcagtcattaagcctgtagaagctgcacccgtagaggctgccccagttaaggcggtt
cctgaaaagaaactcaaaccagaagaatggaagttcaccgaggaactcaaaccagccaaa
ggtttcaagggagacacatgtgaactcgtctgtgaggtaaatgatgagaatgcaatcgtt
gagtgggtcaaacacggcaaggttcttaaaccaagcgacaagtacgagctgaaagaagat
ggcaccaagagaatcctggttatcaaagacgctgtccctgtagatggtgcccgatatacc
tgccagcttccaaagactaagactggtgcttccctcgatgtccaaatcccggtcaagatt
gtgggtgacctgaaaccactgaccatcaccgagagggagactgccgtgctcacatgtgag
gtgagcaataccaaggctgctgttacgtggctcaaggatggcgaacccatcgatataacc
cttgacaagtacgaggtcttggacgaaggtcgccgcaagaagttgaggatcaagaacatc
agtccagaggacgctgcggaatacacctgtcagctgcctaggtcctcgtccaccatgact
ctgacagttaatgaaaagccattggaagtcctttcgccccttacaaaattgttcgcgtac
ctcacgggcaatgccacattcgaatgtgaggtcagtgagccttgggccaaggtcacctgg
cttaaaggtgacaaagaagtcgtgccatcggacaaatacaagatggagtcggatgggaga
ttcagacggatgatcattcagggtatcgctgaagatgacgtgtcggactacacgtgtgtg
ttgagggacaagaagaccagcgctgacctcctcttaagagaaaccatcaaaatcaccaag
cctcctgaagacgaggactctcgtgaaaggcagagtgtcaagttcgtctgtgaactcacc
ggtgatgcagccaaggcggacgtcaagtggaagaagggtggacaggtggtgagaaaggac
aaacgccacaagatcatcaacgaggggttggtatcaacccttgtgatcgaggatctgtcg
ccctccgatgctggaaaatattccgtcctggtggacaacatggaaatgcccttcaccctt
agcgtccaagccttgaaaccacctgtctttaccacaaaaccgaaagctgtagacacacaa
gaaggtatgtctgccatattccgctacgtcatcgccggctaccctgtacccgagatcaag
ttcaccaaggactggaaggaaatcacgccggagaactccgacgtcaccttccaatttgac
gaggccacccaagaacacaaggtcatcttccatgaggtcacacccaaggatgccggcaag
tacctagtgatcgccaagaacgagtctggtgaagtcaagcaggcagtttccatgatggtg
accccacgacctcccgaggagctcatgaagagaaagatgtcactcaaagcgcgtgcatca
cagcaggagatcttcgaagacgaagagatagacatcgaagaaatcctcagggatgtaaag
cccaaagactacgagaccgtactcaagcaacatggcatatttgacttcagagcaatcctc
aagcaactccaagctatgaagaaaagggctgtacaaccagaggatctggaaactctcatg
gaggaacctgagattcctgaacagctcgagtccctggagcttgcagcctttgagatggct
gaatctcctaaggtcatgggtcgaggcaagccagaagagacagacttgactcctttggct
gatgccaaggtgccagagaaaatagctgccacatttgagtgtgacgtgtctcgtgacgtc
aaagatgaagacatcgtttggatgaaggatggtcagaagatcacccccgatgagaagttc
caagtgaaacgtgatggtcgccgtctctctctgtccatccaggacacctctcctgaagac
agtggccagtacaccatcaagatcggcgacaagacacaaacagctgatctcaaagtccaa
gctgccgaatttgtcaaaccactcaataacacatccgccgccgagtacgacgaaacaatt
gtcctcgaatgtgagctttccaacgagcttgttccttgccagtggtataaggatgacgtc
cttatcaccgttgggccaaaggtggaggtcattgatgatggaaagaagaggaagttggtc
ctccatgatgtccgaccagaagatacagggaacttccgctgtgtggtgggtgacaaagag
tcctcagctacactcgacgtcaaagcttctgagataatgaagcctctggcggaagtcaca
gctcctgaatttgccgagactgccgtgctagagtgcgaggtctcccacccgaaggccgag
gccacctggctcaaggatggtcagcccataacacctgaggagctgaccagcaagaagtac
gaggtggtcagcgatggacgcaagagacgtctcatcatccatgatgttgtcaaggatgat
aatgccgagttcacatgtaaggttggagacaaccagactgtagccaatgtcaacgtcaaa
gtaccatccattaccaagcctttggaggacaccacaacagctttcgagaccactgtggtc
ctggagtgtgaggtggacaatgagaaggctcctgtcaagtggatgaagaacggcaaagag
atcaccaagatgcccaagtacctcatggaatccaaaggaaagaagcgccgattgactatc
ttcgaaacaataccagaagatgagggagattacacctgcgtggtgggagacgagtcaact
gtggctgtgcttgctgtcgagcctgcccccatcgagttcctatctgaaatccaatccgtc
caagccgtcgaggatgagcccgctgtcttcacttgtgagatctccgatgacaatgcagag
gtcatctggctgaaaaacgaagaggagatcaaaccagatgacgaaaaatatgagtttgtc
gtcagtggaaagaaacgcggcctcaagatcaaatcaaccgatgtatccgatactgcagaa
ttcacctgcaagacaaaggacaagacgtcatctgcttcccttactgttacagaacacata
cctaccatttcacacaccctcaaagacgtgaagatcgaagaaggttccaacgaagtagtc
tttgaatgcgagactgacgtggagaccgccgacgttgcttggttgcacaaaggcaaagat
attgtcgaagacaactccaagtttgtcattaagcgcaaagggcggcgacattccttgatt
gtgaaggatgtctcggtcgaggacgcaggggagtttacttgtcgaatcggagtacacgag
accatagctgagcttattgtggaagagaaaccagttgagttcctggcacctcttccgaag
gagcaatcagccatccctggcgacgagatcaccttcgaagttgaactcaccaaggacaca
gaagatgtcttctggctcaaagacggccagaagatcaagcccggtgacaacgtcaagatc
gtcaaggatggcaagaagcataaactcatcatcaagaaggttgacttcgatgatgatgca
gtctacagcttcaacgctggagatcaaaagtgcgattgcaacctcaatgtttcagctcca
ccgaagattaatgtggatcctaaactgaccaacattagcgtcaaggccggcacgaaaatc
gctattgaagcaactgtcactggttcacctgctgcagtcacaacatggtccaagggcgac
actccaattgaatccacgaagagattcaagatcgaggcaggtaaaggacccaaggcttcc
atcaggctgaccattgacaagacagagaggtcagatcttggaacatacacactaaccgct
gccaacgacttgggaacagatactgccatcattttcatcattgtcctcgataaaccacaa
ccaccaacgagcctgtccattactgagaccactcctgaatctgtcacgctggtgtggact
gcaccagaggacgacggcggtagcccagtcattgaatacgtcattgagaaacgggacatg
aaaaggaatacctggaccaaggttgacaccacctcagaactcacctgcagggttcctaag
cttgtggaaggcaacgagtacctgttccgtgttagtgccacgaacgagttgggcaccagc
gaaccatttactacctcagaacctgttactgctaaataccagtttgatgtacctcacgct
ccaagcaaaccagaaacatcagatgtcatccagacagagatgaccctaacctggacaccg
cccgacttcaacggaggcagcgaggttactggctacatcatcgagaggaaggaagctgac
aagacaagatgggtgaagatcacaaaggaaaccgtcactgagctgactttccgtgtcaaa
gacttgatcgagggaaccagctacgagttcagggtatatgccatcaacaaggctggtaca
agcaaaccaagtgagccgtcgacgcctaccaaagccaaggctccctatgacgtgccagga
cctcccgctcaaccgacctgtgagaacgtcaacaagactaccatcacagtatcctggacc
ccacccgaagacgacggtggctctcctgtcactgggtatgtcatcgaacgatgtgatgtt
tctcggggtcgctgggtgaaatgcaaccgagataaggtcactgagctgaccttcaccgtc
tctgatctcacggatggtggacagtaccagttcaggatctctgcagagaatgccgctggg
gttggacaaccaagccccacctctgcaaccttcactgctaagcttccatttgatgcccct
ggagccccaggtaaaccacaggttaccgagtacaacatcaccaagatgaccatcacttgg
actcctcctgaatcggacggtggtagtccagttacagggttcgtggtagaacgcaaggag
aagacttcatctcgatgggtccgtgttacaaaggagacagttactgagacaacactcaca
gtgactggtctgaccgagggttctgagtatcagttcagggtcattgctgagaacctagca
ggtcctggaccagctagtgaaccctccgatttgcagaaggccaagttgccgttcgatgtt
cccactgcacctggaaaaccagacatcacctctgcggacaagactgagatggagcttacc
tggactataccagaatccgatggtggtagcccgatcactggctacaccatcgagaagaag
gagaagactggaaagtggacaaaggccatcaaaactgttgtcacagagacaacaactact
gttacaaaattgatcgagaagaaggaataccagttcagggtagcagccatcaacttagca
ggaaccggtcctttcagtgaaccatcggacaacaaaatggcaaaggcaccttatgatgtg
ccaggtccaccttccaagcctaccactgaaaacatcaacaagaccacaatcaccattacc
tggacaccgccagaaaatgacggtggttctccagttactggttacatagttgaaaagtgc
gagggggccagaggtcgctgggtcaagtgcaataaagatctggtgactgaattgacactg
accatctctgacctgcatgagggtaacgactaccagttcagagtgtcagctgagaacgca
gcaggtgttggtcaaccaggtccgccatcagatactgttaaggctaagctgccatttgac
gcccctggagcaccaggcaaaccacaggttactgagtacaacatcaccaagatgaccatc
acatggtctcctcctgaatcagacggtggtagtccagttacagggttcgtggtagaacgc
aaggagtcgacttcatctcgatgggtccgtgtcacaaaggagacagttaccgagacaaca
ctcatagtaactggtctaactgagggttctgagtaccagttcagagtcattgctgagaac
ctagcaggtcctggaccagcgagtgagccctccgacctgcagaaggccaagctacctttc
gatgctccttcagctcccggaaaaccagaagtgacttccgcagacaaaacccaaatggaa
ctcacatgggctgtacctgactctgacggtggaagtccaattacaggatacattatccag
aagaaggagaacactggtaaatggacacaatccctcaagacaaccactactgacactaca
gccacgatcaagagtctgatcgagaagaaggaatatgagttccgtgtcgcagctgtgaac
cttgctggcaccggtcccttcagcgagccatcagattaccagattgcaaaagcaccatat
gacgttcctggtccacccggtaagccaactattttggaagtggacagcacatcaatgaca
ataacctggacaccacctgaaactgatggcggctccccagtcacaggctatgtggtggag
aagagagaccgtgtgtcatccagatggacaaaggtcaaggagacatcaatcgaggaggtt
gtctacacgatcatcgacctcaaggaaggtaacgattaccagttcagggtttcggctgag
aacaaggctggtgttggcaaacctagtgagccatcagaccagcgcagagccaaacctcca
tatgatgtgccaggaccaccaggaattccagacatcagtgacgttgacaagaatcgcatg
accctgacatggacaccacctactgatgatggtggcgctaaaattctgggctatatagtc
gagaagtgtgatgctgatcggaaacgttggaccaaggcccacaaagaggacctggtcact
gaacttaccctcactgtctatgacctaacagagggtacaaactacatgtttagggtcagc
gcagaaaacgctgcaggtgttggagagtccagtccagccacccaaccgaagaaggcaaaa
ccaccttatgatgagccgggcccacctcctcctccaacaccaacccacgtggaccgtacc
tctatccacctcacctggtcacctccagatgatgatggcggatcagaggtcacgggctac
atcctcgagaagagagacaaggctcggaacaagtggaccaaggtcaataaggaacctgtc
cctgagattagcttcacagtcactggactgacagaggatgccatctatgacttccgcgtc
agtgccgtgaacaaagccggtgaaggcccaccaagtctgccttctgatacgctcaaggcc
aaacttccatttgatgttccaggggcacctagcacacctgttccatctgacatcaccgag
acatctgtccatcttgaatggtcacctccttccaacaacggcggtgcagaaatcactgag
tatatcgttgagcaaaaggaccgattctcctcccgctggactaaggctggcgagacacca
ggagatactgttacaatcaccctcaaagacctaaaggaaggcaatgaataccagttcaga
gtgattgctgtgaacccagctgggcccggtagtcccagcgatgcctgcaaaccatttgtt
gccaagcctccatatgatgtacctgatgcaccaggtaaaccagcaccctctgacttgtct
ccgacctctgtgaccttgacctggacacctccaccatctgatggtggaagccccatcaca
ggctacacagtagagatgaaggataaattcagcacccgttggacaaaggccaccagggaa
ctgatctcagagaccaccgttgttctgcctgatctgaaggagaaagaggagtaccagttc
agagtgattgcagagaacaaggctggacaaagcaaacctagtccagagcttcacgtgact
gccaagtatccatttgaaacacctcaagcaccaactattgacaatgtcacaagagagtct
cccacctctgctaccatgaagtggtccccaccaaaatctgatggaggatctgagatcacc
ggctacgtcttggagaagaaggagaagatgtctccacgatggtctcctgtaatcgaatct
gaaactgagacctcattcacggtgaaaggactacctgatggcgagaatgtggagttcaga
gtcagcgctgtcaacaaagctggcactggaaaaccaagtcaagttgcaacattatctgcc
aagccaccaggagctcctgacgcaccggaagtcagtgacatcgacagaacatcagcaacg
gtgacatggacagttccctcatcggatggcggtagtacaatcacaggttacaccatagag
cgaagagaaaagggaagggatcgctggacgagggtgaacaaaagcctggtgaaggacact
accttgaaggtcaacgatctcacggagaagaaccagtatgagttcagagtaattgctgaa
aacaaagtaggtcctggagaacccagcaacccatctgcaagatttacggccaaggctcca
tttgatgaaccggaggctccctactctcttgctgcatctgacatcacgccaacgtccgct
acattgtcatggctaccaccagactccgatggaggcagtcccatcctgggctacactctg
gagaccaaggacagattcagctctcgctggactaaagtcaacaagggtctactccaggag
acctccttcaaagtcactaacctcgaggagaacaatgagtatgtttaccgcgtcatcgcc
gagaacaaggctggcccaagcaagccaagtaatgaatgcaagttcattgcaaaacaccag
ttcgaaacacctgaagcacctggaaacgtggttgccaaggatacgaccccgacctctact
gtcatcacctggagagagccctcattcgatggtggaagccctatcacgggttacaccgtc
gaaatgaaggagccttacagcacaagatggactcctgcaaacaaagaaccaatcgaagag
acgacattcctggtgaagaggttgaaggagaatgagaactaccagttccgtgttgtggcc
cataacctagctgggccaggcaaaccgagtcaatcggttaatgtgactgcgaaatatcca
tttgaggctcccaaaccaccaactcccccagaagtgaaacgtctatctccaacgtcagtc
cagttgaactggagtgcacctacatccgacggtggctcagaggtcactgcctacattgtt
gaaaagaaagacaagtctggacgatggacacccgtgacatcggactccatcgaagacaca
tcattcactgtcaagggattgaaagaaggagaagacgtggagttcagggtcagtgctgtc
aacaaggcaggcactggtaaaccaagtgaggtgactgtcattgcagccaagccaccaagt
gcccctagcaaacctgaggtcacggatatccagaagacatctgcagtagtcacttggaca
gcacctaagaatgatggcggcagtcaggtgacaggctacaccgtggagaagagagagaag
ggacgtgaccaatgggtacgagtcaacaggaaacctgttactgagaccaccatgaaggta
cctgatctcgtggaaaagaacaactatgagttcagggtgatcgcagaaaacagggctgga
cccggagaagcaagtgatgcctctgcaagctttactgctaaagcaccatttgatgagcca
agtgcacctggtgtaccaaaggcctccaatatcacgccgacctctgtgaccctctcatgg
acagctcctgattctgatggtggtagcccaatcactgaatacatcctcgaatccaaagac
aagtacagctccaagttcagcccagtcaccagagacaccgttactgatctcacattcact
gtgaagaacctgaaggagaatggcgagtaccagttcagggttatcgctcagaacaaagct
ggacctagtgaaccaagtagagagacaaaggtcgttgccaaatatgaatttgaggtacct
caagcaccaagtgctccagaagtcaggcgtctttcaccaacatctatccaactcgactgg
actccaccctttgcagatggtggttctgatatcaccggttacatcattgaaaagaaagag
aagtctggtcgctggacacctgtgtcatcggactccgtcgatggtaccaccttcacagtt
aaaggtcttccagatgatgaggatgtcgagttcagaatcagcgctgtcaacaaggctggt
caaagcaaaccaagtcaagtgaccgtcttgactgccaaacctccaggggctccaggaaga
cccgaagtcagcgatatcaacaagacctctgcaacagtgacatggaagccatcctcttca
gatggaggcagcaccataactggctacattgtggagaagagagagaagggacgagaccgt
tgggtgcctgtcaacaggaaacccatcaatgccgtcaccatgaaggtcactgatcttaca
gagaagactgactatgagttcagagtgattgcagaaaacaggataggacagggacagcct
agtgaaccatcagcaaagttcattgcaaagtctccatttgatgtgcctactgcacctgga
gcgcccaaggcctcagacatcactccaacaagcctaactctcacctggaccccacccact
gatgatggcggaagccctatcaccaacttcatcattgaatggaaggataaattcagtact
cgcttcaccattttcaagaaagatttattcgttgagctcacattcaaggtgactggtttg
aaggacaagactgagtataccttcaggatcattgcagaaaacaaagagggccagagtgaa
cctagcaaagagacagtggtcgttgctaagtatggatttgacatccctcaagaacctagt
gcacccgaggtcaagcgactctctccaacatcagttgagctctcttggacacctccaaga
tctgacggtggtgcggacatcacaggctacatcttggagaagaaggacaagtctggtcgc
tggactcctgtcacagactccgtcgacggaacatctttcactgtcaagggtctgaaagaa
ggagagaatgttgagttccgcgtcagtgccgtcaataaagcaggacaaagcaaaccaagt
gaagtgtcgctggtagcggttaagcccccaggtccacctggtatgccagaggtcagtgat
gttgacaagaactgcgtaacactcaactggacaccacctacctcagatggaggaagcact
atcattggatacactgtggagaaaagggaaaagggcagaagctggatcagggtcaacaga
actctggtaaacgagactacaatgacagtatctgaccttgttgagaagaatgactatgag
ttcagggtcattgctgagaacaaggttggaccaggagaacccagtaatccttccatcaaa
tttgtagccaaggctccatttgatgttcctgctgctcctgatgctcccgagccatctaac
gtcacaccgaccactgccaccctgacgtggactccgcccaagcgagatggtggtagcccc
atcaccggatacatcctggagatgaaggacaggtttgccactcgatggacacaggtcaac
acagactccatgactgaggtcacgtgtacactgaaaaccctcaaggaagggacagagtat
cagttcagggtcatcgctgtcaacaaggctgggcagagcaaacccagcgcggaaacagta
gtcattgcgaagcatccattcgatgttccagatgctccaacaattgatgacgtgtcccga
atctcagaaacatcagctaagatcaagtggacaccgccaagtaatgatggtggtgctgaa
atctccggctacatcatcgagaagaaggatcgtctcgccgtgaaatggtcccctgttatt
gaagacaccctcgacaacacctccttcaccgtaaagaacttgagagaaggggaggatgtt
gaattcagagtcagtgccgtcaacaaggcaggtactggcaagccaagttctatagctaca
ttggcagccaagccacctggcccacccggtgtcccagaggcaagcaatatcgacaagata
tcagcaacgctcacctggactcctcctgaatcagacggaggcagtaaggtgactggatat
attgtggagaagagggagaggggactagaccgctggatgaaagtcaacagagctcctgtg
aaggatgttactctgaaggtcttagatctgacagagaagaaacactatgaattcagggtc
actgctgagaataaggctggtcttggagagccaagtgattccgtctcctttattgcaaag
ccaccgtatgatgtcccaggagcaccaagtacacctgttgcatctgatatcagcccgaca
tctgcaacactcagctggtcgccaccttactcagacggtggtagtccaatcacctcttac
accatagagatgaaggaccgattcagctctcgctggaccaaggccaaggatatggtgact
gaggaaaccttccagttaaacagcctgaaggaaaacaatgagtaccagttcagggtgatt
gcagagaacaaggctggaccgggtgaacctagtcctaccgtcaatgtcacagccaagtac
gagtttgacacaccacaagcccctgctgaaccagatgtgaggcgcacttcaccaacatct
gttgagttatcatgggtaaagcccaagtctgatggtggttccaagatcaagggttacatc
atcgagaagaaggtcaaaggtgaaccatggacacaggtgaccacagatactgttgatggc
acctccttcaccgtccgagggctacctgaggatgaggacgtggagttccgcatcagtgca
gtcaacaaggcaggagctggatcaccaagcaatactgttgtcattgccttcaaacctcct
ggacctcctggtacacctgaggtcagtgatgttgataagacatcagtaaccttgacatgg
acaccacccaagcttgatggtggaagcaaggtcataggctacatcgttgagaagagagaa
aagggtcgcgaccgatgggtgcgcatcaatagaagccctgtcagggaggtcaccatgtcg
atcacagatctggtggagaagaacgagtatgagttccgggtcattgctgagaacaaggtt
ggacctggagagcccagcagcccttcagaaagaattgttgctaaagcaccatacgaggtt
ccttctccaccaaaatccctgaaggcaacggacctgacacccatttctgtcacactcaac
tggtctgctcccttatcgaatggaggtagcccgattgttggctataccattgagatgaag
gataagttcagtacacgctggaccaatgtctcagagcatatggtgaccacactgtctctt
aatgtgccaaacctgaaggagaagaatgattaccagttccgtgtcattgcacacaacaag
gctgggccaggtcaaccaagcgagccaatcagtgttactgccaagttcccattcaatgca
ccagaagcaccttcgcctccatccatagagcgcatttcaccaacatcagtcaaactcgca
tggagcccacccaattccgatggtggtgacaaagtcactggttacatcattgagaagaag
gatcgcttctccggcagatggacaccagtaaccaaagacatcatcgatgacacaaatttc
accatcaaaggacttaaggaaggcgaggaggctgagtttagagttgtcgcagtcaacaag
gctggctctggaaaaccaagccagaccactgtacttgcagcattaccacctggaccacca
gaatcaccatccatcagtgatgtcaagcagacttcagtaacgctatcttggactccacca
gaatcagatggaggtagtaagatcattggatacattgtggagaagaaggacatgggccgc
tgggtaaaagttaaccgatcccctgtcagggaaacgactatggtggtgacggacttggtg
gagaagagtgaatacgagttcagagtcatggctgaaaacaaagttggagttggtgaacca
agtgcgccttcatctagagttgtggctaagctgcctttcgatgtacccgacaagcctgat
cagcctgatgtcacagacattgataagaatgaaatgactgtgaaatggtcttcgccatat
agcgacggaggttccaaaatcacaggatacatcgtcgagatgaaagagccatactcatct
agatggtcacaagtgacaaaaaccacagactttacattcaaggtgactcgtctgacagag
ggtaaagattaccagttcaggataattgctgagaacaaggctggccagagtcagccaagt
gaaccatcaagaacattcactgccaagttacctttcggtgttcctggcgccccggacaca
cctgaattgaccgacatcaaggacttctcactaacagtgaagtggttagctcctacatcc
gatggtggctcacccatcctggggtactttgtagagcagaaagaccaattcagcacccgt
tggcagcgtgtcaaatcatccccgatcctggacctcaagttcactgtcaccaacgtacag
gatgatgccgagtgcgagttccatgtcattgccatcaacaaggcaggcgaagggaagccg
tcaccatctgtctccctgaccttcaggctacctggtcctccaggaacgccagaggtatac
aacccctctgacaagtctgttgacctgagatggactcctccaacagaacaaggaggaacc
agaataattggttacttcattgagaagtgtgaagtcggcaaggacaactgggtgaggatc
aaccgctcgtccatcagggaagctaactacgttgttggcgacttgacgctgaactgcagg
tttaaattccgtgtctgtgcagagaacagagccggtgtgggacccccaagcgattattct
gagtctgtcctcatcaaactgccctacgatgtccctgaatcccctgacactcccaaaatc
tccgatgtcaccaatgattcaatggtgatcagctggcaaccaccctactctgacggagga
agcaaagtcactgaatatatcattgagaagaaagaaccttacagctccaagtgggtccca
gttaccaagacaagagacctgagctacaagatcactggtctgaaggagaatggggactac
gagttcagagttgccgccgtgaataaggcaggggccagtgaattttcagtacctacgccg
tcaaccaaggctaaactaccctacgatgtaccatcacagccacactcattgaagatcgct
gatgtcagtcctacatcacttacattggaatggagtgagcctgatagtgatggtggtgat
aacgtatcgggatacattattgaaaagaaagacaggttcagtcctcgatggacccctgtc
aaccagaccgctatctctgacacaaagttcaaggttacaggcctcaaggatgggcaagac
tgcgagttccgtgtggtcgccaagaacaaggccggagccagtcagcctagcagtgtggcc
acattctccatcaagcctcccgatgcaccgtcgcgacctgacatcaagaaggtcaccgag
aactccgtcaccttgtcctggtcaccaccagaatccgatggaggaagccctgtgaccagc
tacatcgttgagcgtcgtgagcctgatagggattactgggtcaaggccacaagatatccc
atcactgacactaccttcacagtccaggatcttactcctaaacacaagtatgagttcaga
gtgattgctgaaaataaagccgggcttggaggagctagtgaggctagcaaatccgtcatc
gctaagccgccatatgatgtacccgatgttcctgtggacttggatgttaccaacatcacg
aagaacagcgctgaactcttctggaatccacccatggatgacggaggaagccccatcaca
aactacgtcgttgagatgaaggacaagttcggtgtcaggtggacatcacttggcaagccc
accaagacgagcttcaaggtcaccaacttgaaaactggatctgaatatgagttccaggtc
cgagccgaaaacaaggctggagaaggagagccgattcagtcaaccaagcctattgtggca
aaggatgcttatgatgtacctgatgcaccagaaaaaccagaaccaagcagcctcacagag
acctctgtcaccctcacttggtcgccgcccgcttctgatggtggtagccaaatcacaggc
tacattgttgagaagaaagaagacttcatgacacgctgggttaatgctacacgagatgcc
atccacaagaccacattgaccctgaatgacctcagagaggggtcagaatacaccttccgg
gtcattgccgagaataaggctggccagagtaaacctagtgaaccatgcagaccattcaag
gctaagaagccatatggtgtacctgatactccagggtcacccgaagcatcgaacatcacc
gagacttctgcaacgctgaactggaaagcacctacttcagatggtggcagtccaatcacg
aactatgagattgagaagcgtgaaggtgcgtctggacgctggaccacgtgcaacaggttt
gacgtgagcgagacatcattcactgtccgggacttgagagcaggtcatgagtactctttc
cgtgtggcagccgttaacaaagctggatccggtaaaccaagtgtgccttcagaaaccttc
aaggcacaaccaccctatgctgcccctgaagcaccatcagcccctgtcatcgaggaagtc
actgccaactccgttaagttgtcatgggaaccaccaagactggatggaggtagtcacatc
atcgactatgtggtggaaaagaaagatgccttcagcatccgttggacagaggtcaaccgg
acaccagagaccacgttcacggtgcccaagctgaaagagggtgacgctgtacagttcagg
gtgaccgccgtgaacaaggctggaccaggcaaaccgagccagtcttcagtcactgtcaca
ttgaaacctgaattcactgttcctgaggcgccctctcaaccaaccgctgtagaggtggat
gctgtatccatcacagtgaggtggtcagcacctaagaacgatggaggtagccgcatcacc
aactacatcctagagatgaaggaacagttttcgtcattctggaagcgtgtgtctaccaaa
gagagttctgaactgacataccaggtgacaggactgaaggagaaccagacccttgagttc
cgcgtgatagcagtgaacaaggcaggagagggcaaacctagctcagtgggtggacctttc
acaaccaaggctacctacactgtcccatctgcgccaggtgcacctgatgtcagcaacgtg
aaggccacctccatggctgtgacctggacaaagtccatctcggacggaggcagcccgatc
accggctacgttctggagaagtgcgacgtcagcacaggacgctgggtacctgtcaatcgg
gttccactcagggagaccagtctcgttgtggaccaattgagggagaagtcagagtactgc
ttccgggttgtggcgcacaatgttgcaggggagagcaaaccaagcgaaccttccaaggca
tatattgccaagccaccatatggtcttcctgatgccccagccaagccagacatcaccaac
atcgacgccaagcagatcacccttgcctggtcccctccttggtctgatggcggttctcca
atcatcggctaccagatcgagaagaaggacaggtattcggtccgttggacacgtgcaacc
cgcgagacaatccacgatatgcagtatacgctgcgtgagttaacggaaggtggagaggtc
gagttcagagttgcggcagagaacaaagctggagttggaccattcagtgacactacaggc
actgtgatcgcaaagagtccattcgatgttccatcagcaccaggcacaccaaagatctct
gacatcaccggaacatctctggtcctaacctggaccccaccatcctcggacggcggtacg
gagatcaccaacttcattatagaactgcgtgataggtatggacgctggacccgagtgaac
cgaactcaggttctcaaaaccgggtttaacgtgatgaatctatctgaaggtgacagctat
gagttccgagtgacagcggagaacaagatgggtgtcggaaaacctagtgactcgacccag
aaggtcaccgctaagccaccatacagccaacctgcagctccgaacgaaccccagatctcc
aacgtaacggccgactccgccaccttgacttggtctccccccagggacgatggcggaagc
tccatcaccgggtacttcatcgagaagaaggacaagttcagtccacgatggactagggtc
aaccacgatgcagtgacagataccaagttcactgttccagccctagtccctggtgaggag
taccagttcagggtggtggcgcagaacaaggccggtgctagcaaaccgagcgaacccacg
gaatcaaccctcgttagatcaccgttcaacgaacctggagcaccgggtgcccctgaaaca
agcaacgtcaccgaaacgaccttgaccctgacctggaccccgcccttctctgatggtgga
agccgtatcaccggctactatgtggagaagaaggatcgtatgtctctcaggtggagtcct
gtcaactttgagtcaaccgaggataccaaactcaaggtaacgggattaactgaaggaacg
gagtatgagttcagagtcgtggcagaaaatgatgctggccgcagtaaacccagcgcaccc
agctacccagtgaaggcaaagtcaccattcgatctcccaagtgcacctggcactccatcc
atctcggacatctcctccaccaacatgaccctccgttgggccccgcccgaatcagacgga
ggaacggtaatcatcaccttcatcgtggagcgcagagagcagttctcaacacgatgggtc
cagattagtcgctttgacttcacagagaccacattctctgtgactggcctcaaggatggc
aatgactacgagtttagggttgctgctaagaacaagatcggtattggtaaattcagcgag
ccaacaagaccaacaaaagccaaggagccatatgatgttccagagtcacccagcacccca
gatgtcagcaacatcacaggagagtccatgaccctgaactggacagccccacgcaccgac
ggaggcagtccaatcacaggctacgtcattgagaagagagagcctggacggagtggatgg
acggtggtcaatcggtcacccatcaccagtctctcctgcgtggtgcccaacctcaggcag
ggagcggagtacgagtttagggtgattgcagagaacaaagctggtctgggacgcccaagc
caggttacacatcctttcactgccaagccccttacagtaactacaccaggcattccagat
caacctgaggtagaggacgtcacagcgaccaccatcaccatctcctggagcccaccatcc
tatgacggtggcagcaagatcactggctacaccatcgagtccaagagcgatgccaccatg
cgttgggtgaagatcgagagcactgtaccggacaccacgtacactgctgcaaggctgaag
gagttatcagagtaccagttcagagttgcagctatcaacaaggcaggacgtggcgacttc
agcaaaccatcccgccctgttacatgcaaaccaccctatgacccacctcctccacctgat
gccccagacgtgtacaacatcactccgaccagtgccgctctgacgtggtcaaccccacgc
caggatggaggatcccccatcacaggttatgtgatagacaagaaggacaagtattctact
cgttgggtcaaggctgatgaagtacctgctggtactacagatttcaccatcaagggtctc
caggcgggcaatgactacgagttcagagtgagcgcagtcaatgcagcaggagtcggcaag
cctagcgcaccctgtgaaagattcactgcaaaggcccaatacggtgttcctgatgcacca
agcccaccttccgtctcggatatcacaccatcatccatgactctgtcatgggaaccacct
gcatcggacggtggtagcaccgtcacagggtacatcgtggagaagagggaatgccctgtg
ggtcgctgggtccctgtcaaccgtgctccagtcaaggagacgaccttcaaggtcaatgac
ctatcagaggataggaaatatgagttcagggtcagcgcagagaatgcagcaggtgttggc
aaaccaagcgaggtgtctctaccacgagttgccaagtcaccatatgatgctccaagtgca
ccaggccgcccaacagcaaccaacgtagactccacagagctggtcctcgaatggaccgca
cctgtcgctgacggtggcagtgcaatcaccaactacgtcatcgaggccagggacaagttt
ggtctccgttggtcaaagatcaaccgccagacagtcactgacacaactttcaaggtgact
ggactaaaacccaatgatgagtatcagttcagagtcattgctgagaacaaggtcggtcta
ggaagaccaagcgacaataccgagcccatcgtagcgaaacctccttatgacactcctgac
gcaccagaaagtgtccaagtaacaggaaccacagcctcctccgccagtcttgaatggagt
cctccgttctctgacggcggttcaccagtcactggctactttgtagaacgcaaggatcag
tacagtgccaggtggacacgtgtcaacagagttcccgtcacagagacgaacatggttgtt
ggagacctcaaagaaggcctacagtaccagttcagagtctgcgccgagaaccgggcaggt
attggtcggtccagtgactcaactaaaccaacagtaatcaaggatccagttgatgcgcca
tcagcaccccttgagccaactatcgccagcataaccgcagactctgctaccctaacatgg
acagcacctacccgagacggcggttccgctgtcacagggtacattgtagagcgcaaggat
ccctacactgcacgctggacacccatagagaggtgtacagacaccaattgcaagatctca
ggacttaaagagggtaatgaataccagttccgagtgttggctaccaacaaggcgggccag
agtgcaccaagtaacccatcacaacccaaggttgctaaatcaccctatgatgttcctgaa
gccccaagcaaaccacaggtagcagaagtaaaggcaacatcagtaacactcaagtggcgt
ccgccaggcagtgatggtggctctcctgtaaccggatatgtcgtgcagaagaaggaacga
ctggcacttcgctggacaccagtcaataccacaccagtgggcgatactatcttcacagtc
accggactcactcagaaatcggagtatgagttcagggtggtagccgcaaacaagaagggc
ttcggccaaccaagtgaaccaaccaactctgtacttgtgaaacctccctatgatattcca
ggaagaccatcaccaccagttgtcaccgacttcaccaagaccagcgtgacccttcagtgg
aacccacctgaatcagatggaggcagccacatcacgggctacgtcctagaaaagaaggag
gcctactctgtccgatggttcccttgcacgtcgcagtccatcctcaaacccgaattcacg
gtcaaagacttgaaagaaggagcgcagtacgagtttagagtcatggctctgaacaaagcc
ggtctcggaccacctagcgatggctcagagttagctactgccaagtccaagtttggtgta
ccttctccacctggtgagcctaccatctccaacatcaccgcaaagtctgtgaccttaaac
tggaccgctccgtcttcagatggaggaagcccagtcacaggatacaccgtggaacgcgca
gatcgcttcagcacccgatgggtaccggtcaactcacatcctatcaaggatacaaagatg
gatattcatgatctcccagccacaggatcatatcaattcaggatcgttgcttgcaatgct
gcaggaacgagcaaacctaccaacccaactgattctattggcatggctgttgcaccgaag
ttggatacctacaagtaccacgacaccatggtagtcagagtaggagctacgttcaacctt
gatgtaccgttcaaagctacacccaagcccactgtcaagtggaccaaagatggctccacg
cttcaagcatcatctcgcatcaagatcgacacaacagacagggataccattgtcactatc
aagaactgtgtgagagaagatgaaggatcgtttaaactcgacgtttcaaatacagctgga
agtgatgccatcacaatccgtgtccaagttctggatcgcccagagcaaccacgtggacct
ctggtcgccaaagatatcggcagcactgacctcttcctgtcgtggaaggaaccagcagat
aatggtggctcaccaatcacacactacatcattgaaaggcgtgaggaggatagaacatcg
tggaccagactaacaacacgtgccctggatactaccgtacgggttacaagtctacaagag
ggtgcgtcctacgtcttccgtgtgtttgctgtcaacaagatcggtgacagtgagccactt
gaaacgaaggaaacaatcaaactaaagaagaaatacgatgtacctgaagcgcctagcaag
ccccttgtcaccaacgtgacttccgactcggtgaccctagaatggcattcacctaaatca
gatggtggtgctccaatctcaggatacatcatagaaaagaaggaaacatccagcaactat
tggtccaaggtgacgaccgtatccagcggggtgacatcacacaggattcctcgtcttatg
cgcggtgaggagtatgagttcagagtcagcgctgagaacagggctggccctggacctgca
agtacaccttctgctccgatcagggctgaggataccacagttttaccaaagttcagcggg
cgctttgatgaaccaattatggcaaaggttggtgagtccttccgtattgaggtaccctat
accggtatccccacgcctgctgtaacatggtcattcgatggccgacctcttaagccatca
gctcacatcaggatagataccagtaaccgtgcatcaacaatcaccgtgaagaatgtagaa
aaggccaatggagggcgctacaccatcaacctgaagaacaccgcaggtgcagaatcctta
gatgtagaagtacgtgtgtttgaccgccctggtcctccacgtgggccacttgaaatgagc
aatgtctcagagagcactgtcacactttcatggagcccgccctctgatgatggcggcagt
cgcatcttcacgtatgtggtgcagaagcgtggtgagatcgagaccaaatggaagcacgtc
aacaaggattacatcatcgatctgacgtacaaggtgacaggactgaaggagaataagaag
taccagttccgtgtgctggctgagaaccagtatggacagagcaaacctcttgaaggacaa
agcatcacacctcagggacagtacaatgttcccgaccctccatcagctcctaaagtcacc
aacatcattggagactctgtcactgtcggctggactccaccatccaacgatggtggtgct
cctgtcacagggtatgtcgtcgagatgcgacagaccacaagtccacgatggatcaaagcc
accctgaccccgacccctgacacgaccttcagagcgtctcggttgatccgaggcactgag
tatgagttcagggtttgtgctgtcaatcgtgcaggaacaggccgtccaggcgagccgtca
aacactgtaatggtggaagatccagctgtaaaaccaaaattcaaccttgatgcccgcttt
gagaaggtaatcaccatccgggcaggccacacattccgtattgacattccctacaaagcc
actccaaccccaactgtatcatggacccaaaacggagacaccgtccagaagtctaaccgc
atcaccatcgacagcaacaactacggtaccacacttaccgcaagaacagctgagagaaca
gacagcggtgattatgtcataagggcttccaacaaggcaggagaggatacagtgacggtg
acagtgaatgtcgttgatagtccgtcaccacctcaaggtcctcttgcacttgtcaagctg
ggtagcaatgaggtgaccctatcgtggagccgaccgcgggatgacggtggtagtccaatt
acaggttacgtgctggaaaagagagagggaggatatggatcgtggaccaatgtctccagt
aagatcccagatacaacattcagagtaaccaaactcaccgaggacagagaataccaattc
cgtgtcagggctgagaataatcttggagtcagtgagcctcttgagagcgaaaggatcatt
ccaaagggagattacgatgtcccagatcaacctggcaagatcaaggtggacaccatccag
tcggacagcgtctccttgacctggtccagacctcaaagagatggtggcgctcctgtcact
ggatacatcgtggagaagcgcgagagaggccaaccagaagccggatggaacaggacgagt
tacaaacccgtcatggatacgactatcagggttccacgcctgtccgaaggcaaggaatat
gagttccgcgtcagtgctgtcaacaaggctggcatgagtactcctgcagcaactgcagct
cctgttatcgtggagagaccgtcttatgcaccaaagatagatcttggatcacaattccgc
gacgttatcaccgtccgtgcaggtaccctcttccatctcgacgtcccaatctcgggcaca
cctacacctacagtcgcatggctgatggatgagaagcaggttgatgatggaagacgcatc
aaggcttctaccacaacatacagcgccgtcttgacaaacaaggatgcccgtagaacagac
agtggcacctacaccatcaagatcagcaacaaagctggcactgatactgcaaccatcagg
gtagcagttcttgacaagccatctgctcccgaaggacccatcaaggttacaagcatcact
tgcgactcggtcacgctggcatgggagccacccaaagacgacggtggtgctgacatcact
ggatacatcttggagagacgagaaccagaccaattccgctggaccagagtgacatccaca
ctgtccagtccccgctatgctgtgacgggactgaaggatggcaggagttacctgttccgc
gtcagagccgtcagcaagtacggggagagtgaaccacttgagacagaggatgccattttg
atcaagagtgcctttgaaaaacctccagctccaggcgttcctaaagcctccaacgtcagg
gatgacagtatcacattatcatggcaaccgcctcacagtgatggaggagctgagatccac
aactatatccttgagatcaaggagaccagaggaacgaggtggttgagagctacaaggaaa
cagctcaagagcccgaacttcagggtgactggactgtcaaagggaagggagtacgagttt
agggtagcggccgaaaacgaggcaggactgggcgcattcagcaaaacatctgcacccatc
gtctccaagacaccaatcgaacttgccgagttcgtcgagcccctcaaggacgtctccgcc
aaggcgggtaagatagttaccttggaatgccgcatctccaaccccaatgcagaagtcaag
tggatgaaggatggcttccaaatcttcgggtacgaccgcgtcaatgagatcaaggagggt
caacgtcgtgctatcaccctccgcaacgtaggggacagggataccgggaagtactcttgc
gagtgtggaaaacaatcgacctcctgctggctctctgtgacagcaccacccaccattgat
gtcaaagcatacaaagacgttgtcgtcgtcaaaacgggcaacacactgcgcctgcttgtg
ccatacacaggatgtccttcccccaaggtggaatggcatcgccatgacgcccgtatcagt
gaggacaccaggacacacatagagacccgtgacaaccgcacgcagataaccatcaggaac
gttgtccgtggcgacactggcaagttcagcattacgctgaccaacgaggctggacaagaa
actgcaatcatccgcgtaaacgtcattgacgtacctggcccaccaactggcccactggag
atcaccgatgtcggccgccactgtgtaagcttgtcttgggaacctcccaaggacgatggc
ggttctcccatccagtcctataccgtcgaacagcgtgaggcaaatcgtaggatgtggacc
tcggtctccaactacgtgtcccatgttccgttcacggtctctggactgagtgagaaagtg
gagtacgagttccgcgtatgcgcagagaacatcaatggagttggaccaccgcttcatggc
attgaacctgtggtcattgtggctccttattctgtgcccacaccacccggtaagcctgag
atcagcaatgtccagcgtgaccgcatgacactgacctggtcagagcccagccacgatggt
ggcaaacccatccaagggtacatcatcgaacgccgggagaacttcagcaaacagtggaac
cgggtcaaccgcgacctcatcaaagatacaacgtttacgatcaagggcctgacagaagga
agtaactacgagttccgtatcagtgcagtcaatgacactggcattggtaacccaagtgaa
gtctcggcaccgcctaaacttgccagatcccctgcaggccgacccacaccacccggtgct
cccatcatcggcgacatcacggcgacctcagtcagcctctcctggtcagcaccctcgaca
gacggtggtagcgagatcacacactacatcgtggagcgaagactcaaaggctcctatatg
tggatcgacaggacggtggtccatgacacaagctgttccgtcaataatctcgtcgaggat
aaggagtacacattcagggtgacggctgtaaatgctgccggcaatgagagcgacccgagc
agggcttcggagtcattcgtagccgaatcacagctgcctggagcagccccatcaatcctg
atagagatccagaatgctatggtagctgagggacagactggcatgtttatgtgcaagatc
tctggcgctcccaaaccaaaggtttcctggatgcatcatggtagggagctgatgcccggt
aggaagcacaacattacagaagataatggtgtcttcaagatcgttgtcttctcggtgacc
gactatgagactggcatgtacaccatcattgccaagaataagcatggctcagtcagatca
tctgctgagctcctcatccagagaccacctcagctaagcattgaccgccatctccaagac
ctatcggtcagagctggacaggagatccacattccggtgacactgacctacggaacaccc
aaacccacattcacatggcgaagacacgatggtgaagagttggatacacgtggtcgttac
agcaccaaagagcaaggacgtgttcatgactttgaacttcctgatctgggagggaatcga
taccccctctcaggtttctacacgctcaagacagagaagctactgagagaatccggatgc
ggcacaacctgggcgaacaataacttactgtcttcaaagaaattgagggtgaatgtggtc
ggaggaatcgccgagttgtatgtgaaggatgccgagagagaagattccggtacctacaca
ctggaagcagtgaatgagctaggacgacacagcatcacagcaagggtcaatgtactagac
cgacccggtccaccccaaggaccaatctccatccagtccatcaccaacaactctgctacc
ttcacgtggaccccgccccttgacgacggtggtgcaccaatccagcgttaccaagtgtcc
atccgagagtccaaccgcacccactggcaaccactcggcacctccttgctgcctaacttt
acggctaagaagctgaaggacaatacccactacgtgttgagggtgacggctgagaaccag
tatggcactagtaggcctcttgagatcagagaagctattctggtcaagagtccatttgac
ccaccaagtgctccaggcaggccaaccatcagcaacatccagcgtgactctgtccatgtc
tcctggaccgctccatcttccgatggaggttcttcgatcacaggttacatcatcgagaga
cgagacaccaccagtcagaggtggatcaaggccaaccacgagcccgtcacaaccaccagt
cataccctcatcaacctcagggaagatacagagtatgagttcagggtcatggctgagaac
agcatgggagccagtgaaccatcaactgtgtctcagagagtgctggtcagagatccaatc
gacactgtacctccccaatttgtcagcaaacctcagaacgctcatgtagcagaaggcaag
agcgtgaccgttacctgtcaagtcagtggttatcctgccccagaggtcagatggtaccgc
ctgggtcgtgagatcgcccatggtcgcaagttccagatcggcggagacggcaacatccac
accctcactgccaaccaactcttcccagaggatgtgggagagatctctgtcactgttacc
aacaagggtggaaccattaccgacgcatttgagctcaatgtgcttgtcatgcccaagctc
accttaccagcccgactccgcacaccaatccaccttctcctgggcgagtacatcatgctc
aaggtgcctttcagtggcactccaagacccagcatcaagtgggacagagacggagaggac
gtggtggatggaggtcgctttgagatcaaggccacacctcatgataccacactcatcata
cgtggaattaccaaggaggatgctggaaagtacagcgtggtggcttccaatgagcttggt
catgatacctgctccatccaagtcaacattcttagacatcctgattctcctcgcaacctt
gaatgcctggagatcacatcagaagccatccgccttgcctggaacccacccatctacgac
ggtggttccaacatctcctcgtacatggtggagaaacgggaagtaggtgtcctcacctgg
gccagggtcatcagctccaagaacacccatcacaccgtcatcaaccttcgttcagatacc
cagtatcagttcagagtcaccgccttcaacatgtatggagccagcgagccttgtgaagca
actgctgttatctgcaccaagtcatcaaaggctggcagaccacagtttgaggattatgaa
ggaaaacgtcgcttctatgactctctggtcgactatgacagaggccctcatccattcgtc
aatagggaaggctccatatacgattactaccagattctggaggaacttggaagaggatca
tatggtattgtctaccgagccatcgagaagaaaacccagaagacctgggcagccaagttc
atgcgttgctttggcaaagagcgtgacctggtcaggcgagagattgaggtcatgaagaag
ctccatcatcgtcgtcttctcaacctccacgaggtctttgagaccaacgaagaaatcatc
atgatccttgaattcttgtctggaggagagttgtttgaccgtctggtcgatgagaaccac
atcctgacagagcctgaagttatcttctacatgaagcagacctgtgagggtgtgaagcac
atgcatgagaggcacttggtccatcttgatctcaagcctgagaacatcatgttgtgcgct
cggaacagcgacgacatcaaaatcattgacttcggtctgaccatggagctcgacccagac
aaacctgtcaagatcatgttcggtacacctgatttcatcgcgcctgaggttgtgaatcac
gaacccatcggactaccgacagacatgtgggcgctaggtgttatcgcatacctcatgttg
agcggtatatcaccatttgagggagagacagaccgtgaaaccctcaagaatgttgccaca
ggagaatgggactttgacgaggaagcattcgctgacatctcagatgaaggtcttgactgg
atcgagaggatcctcatcaaggggaaagagggaagaatgaccatccaagaagctcttgac
catccttggctccagatggagactgatgagatggccagacgccgtgctcgtcgccttgac
aacagccgactccgcaagtaccgtgacaaaaacgcaccaaagggtgctggacgaactgtc
aatgccattggacatctggcccatggtggtgcccttcgtgagatgcacaagatgtaccga
ggcaaacctctcatggagagggaatgctacatggatgtccgcgatgcagcacccaagttc
atcaagcccttggagaacaccatggcgatcgaaggtaacgctggtcgctttgagtgtgag
gtctccgccctctctgaacctctcatcacctggttccgaggcaagcaagaactcattatc
agtatcaagtacaagatgctctacgatgaccacaagtacaccctcatcgttcaagattct
gagttcgatgatatcgacgagtacacgtgcaaggcggtcaactcttacggacatgctacc
tcatctgccagcctagatgtgcaattgctcgatgcgaaagagctagactcaagaggagaa
cgcagaggtcttgacatgaagagaaagaagattcctctgggtgaacgagctaagaagcta
agaaaagcccaggccgaggcacccagcagtgacaaggctccacagctgatcagaccactt
gaagaccaggaatgcggctttagcttcatcatgcctctctctttccaagttgccgagatc
ccaggtatgcctgaacccaaggtgaaatggtatcacgaggacaggccactgaagcccggt
gctcactaccacttctacgaggaagatggagtccacacactggagattgacggtactact
gagaaggataagggccagtacactgcagagatttccaaccagtacggaagtatcgcaacc
aagtgcagactggacgtcaatgaactattcttgaccaagttcaaggactaccgcaaacct
cacttcgacctccacctgagggatatcttcattgtggaaggcagtgctgctagactcgac
tgtaaggtgactggagtacctgaacccaacatcagatggttcaaggaccacaaggagatc
tttgatggccagcactactcgatcgagtttggagaagacgatgaaacctgtagcctcatc
atccaagaggctttcctccaagatgcgggaacctacacctgtctggcctccaacctcctt
ggaagaatctcctgcgattcctacgtcagggttgaacgccttggggtggatagcgaggga
ggatccgcacgttcaattttgcatgtgaagcagttatataaaagaaagttttacagggag
tctagcgaggacgagcgtgtggtatcccgatctaagatcgaaccggtccgaagcggcagc
cgcgtgcaactaccgttcttcagtctgccgctacgccgaaagaccgtgtacgacggcgaa
ccggcgcgtatcagctgcaacgtgcaaggaacaccgaagccgaagatttcttggagcaag
aacggtgtaccgatctacgatggaacgttctacaatatcacctaccgatggggcgtggcc
atggtcgagatccgtcacgcaagcaagagcgacaccggtacattcaggtgcactgccaaa
aacgcggagggtgaagcgacctcagcttgcgagctggtcgttgaacaaagagtaccacgt
agtgaaacagaggactacatccgtccgtctttcgccaagccgctgcgacgtatccgtgcc
aaggaaggcaggaaggtccggcttgagatccaagtcatgggatggccggaaccaaaggtc
acctggttgaaggacaacgtcgatgtcgtgcactccgatcacatgtacgtcgagaagttc
cctaacggacttcaatccctggtcatctaccgtgtcgtaccaacagacgcaggccgctac
caagcgatcgcttcgtcaccagctggcaaagcaacgtgctctgccgatgtcgacgtgatt
ccaggggaagcattaccagatcgcggtggagatgttgggcgtgggcgtcataagactcgc
aaggcaccacgatcacctcgcagttacctcgatgttgccaccgagagtacccgccctcat
caaaagcgttctaagcatctacgcgacccatcaagcctttcaccaacatacaactacgaa
tcgaagcgcacacaacgcaaggattattacacaccaagaaccgacgttcttgcgccgtca
cgcagccgctctttcagtccgacgtcaccaacgggattatcgccgtcatcgcgctattct
ccatcccgcccgcatacgccatcgacctaccgcccgtcttcaccaatgggaacgtatagg
ccttcttccccgacgtatcgttcaccgtcaccggcttaccgccccgcatcgccgacatac
aggccgtcatcaccataccacagctacgcaacatcaaaacgtctaagtagccgacaaggt
gtagaagactcgggcgtagactattatcaggcaaggtctgacagaccttcgcaatatgct
gaaatgaaggaatctcgtagaacgacgcgagactctggacccgggtttttggatgtaacg
cgcacatcggcgacattcacgcgatctggtggcagacccctgccaaagttgacctcttac
accgcgtggtatgataacatgcgaggcaaccgcgatcgaccatcgacgccaacaacgact
gaccgcacacgatacactgagccataccgcccagcatacactgagccgtaccgcccagtg
gtgcgagatcgacctgtggcggggcccacgaggataccgcgtcgcgtctaccgcagcgaa
gaggaggactattactcagcacgccaggttacaagtccctacaaactggatgacaggtac
agccgagagtatggcggttacgaggtaagcgatgatgagtttactatgcgaacatacgca
cccagcgcttcgggagtcgcagccgacgacgaggaaccagagtatgcggcaccagaagaa
ccagaacaggccggacctccgtcctttgacaagaagttccaggacatgtctatccgtgat
ggagaaagggtagtcctggaggtagtgattaccggctctcgtccaatggacgtcggctgg
ctccgcaatggacaggacatcgttgactgcaaggagttccgctacgtgagccgtggcaac
atctaccagctggagattgcagaaatcttccccgaggacagcggcaagtacacttgcgaa
gccctgaacgaccacggagaatccgagtgcagcgccatgattaccgtcaatgaagagcca
agcgtaagcatcagtatctcacagagcatggatgttgatgttagtctgagtacagacatg
ccatgcacagccaccatggacgaggatcacatcccaccagagttctttgaagaacctcag
tcacagatggtagaagaaggcaccactgcagtcttcacgtgtgatgtagatggtgaccca
gtaccctctctgacgtggtcaaaggatggtcgtccgttcacagacggtggtcgtttctcg
atccgaagtgacaagttcacgcacaccttagagatccagaatgcgcgctcaaccgacgct
ggtgtatacgcctgcacggccaggaacagcgaaggcgaggtcgtttgtgagttcacactc
gatatcctgccaaccggtgctgatgataagggaatcaccgcctctgatgtcagtagtgct
gcagcacgtgactctgcagagtctgccaagtcatcctctgcaccttccgccgaaccatcg
gcatcaacagcaccccagggctctgctggcaagggacctaaagacggcgaatcaacaaca
ggagtttctggatccgacacagattcacaagaaggaggtccacctaagttccttaggggt
cttcaagaagagtatgcctgggaggaggacgaggtcgtacttgaatgtcatgtccaaggt
gttcccatgccaaccgtcaagtggtttgtccacaacaaggaaatcgagtcggacaagttc
gtggtcatcacaatggacaacgacggcgttagccgcctcaccatctctgaagctttcgcg
gaggactcgggcgtgtaccgctgcgaagcgaccaactcttcaggaacggcttcaacgtcc
ggagaactcatggttgcaggtaaagtggtcgttcccaaggcacctggcggtaagccaaag
gtggaacaagcctccaagacctccttcaagatcacatgggcagcaccagcagaggatggg
ggaagtcccattttcaactacaaggttgacggccgaaaagccaaagaaacagggtggacc
gaagtcgcaaacgtcactcaaacatcctttgaagttacgggcatagtccccggtgttgag
tacgtttaccgtgtctcggccgaaaacgaagccggctggtccccgtcaactgcaatctca
gatcgcgcagttattacagagtcagagtccccgccaaaaacgtcatctagcaccgacaaa
ccgccagttgtaaaggacagtccacccaacaaagatcaagcaggaaaaggccccggccct
aagccatcagcagccccaccccctccccctaagcgaggaggtggagctttagctaaccgg
atggccaaattctcaaagtag

DBGET integrated database retrieval system