KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591319Help
Entry
591319            CDS       T01019                                 

Definition
(RefSeq) L-xylulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00040  Pentose and glucuronate interconversions
spu01100  Metabolic pathways
Module
spu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    591319
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     591319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 DUF2688 Sacchrp_dh_NADP ApbA RmlD_sub_bind 3HCDH_N Shikimate_DH NmrA
Motif
Other DBs
NCBI-GeneID: 591319
NCBI-ProteinID: XP_030840291
Position
Unknown
AA seq 246 aa AA seqDB search
MEICFKNKRALVTGAGKGIGRGIAVALAKCGASVTALTRSQADLDTLKQEVPGIETICLD
VHDWDKTNEVLSPLPPFDLLVNSAGVSSGESCLEVSAEAYDNVMMINHRAILQITKIVAK
GMIAKGEGGSIVNLSSIASLQGLTNHAVYASSKGALDSYTKVAALELAKHKIRVNCVNPT
VVLTPMARKFWAQGEMRDAMINRIPLGRFLEIEDVVNPVIFLLSDMSAMINGITMPIDGG
ASAALV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttgttttaaaaataagagggcccttgttaccggtgccggaaaaggaatcggt
agaggaattgcagtggcactagcgaagtgtggagcatcggtgactgctctaactaggtca
caggccgatttggacacattgaagcaagaggtgcctgggattgagacgatatgtttggat
gtgcacgactgggataagaccaatgaagtactatcacccttacctccttttgacctcctt
gttaacagtgctggcgtctccagtggagagtcctgcctagaggtctcggcagaggcctat
gacaatgttatgatgataaatcatcgagcgattcttcaaatcacaaagattgtggcaaaa
ggaatgatcgcaaaaggcgaaggtggttctatagtgaatctttctagcattgccagtcta
cagggactcaccaaccatgccgtatatgcatcatccaaaggggctttggattcatacaca
aaggttgctgccttagaactggcaaaacacaagattcgagtgaactgtgtgaaccctacc
gttgtactgactcccatggccaggaagttctgggcccaaggtgagatgagggatgcaatg
atcaacaggataccactgggcaggttcctagaaattgaggatgttgttaatccagttatc
tttctgctcagcgacatgagtgcaatgataaatggtatcacaatgcctattgatggaggt
gcttcagcagccttagtctag

DBGET integrated database retrieval system