KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592021Help
Entry
592021            CDS       T01019                                 

Definition
(RefSeq) exportin-5 isoform X1
  KO
K14289  exportin-5
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    592021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spu03016]
    592021
   03036 Chromosome and associated proteins [BR:spu03036]
    592021
Transfer RNA biogenesis [BR:spu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    592021
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     592021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N Vac14_Fab1_bd MMS19_N
Motif
Other DBs
NCBI-GeneID: 592021
NCBI-ProteinID: XP_030854671
Position
Unknown
AA seq 1207 aa AA seqDB search
MELEEQTLQLIDAVNVTMNPVIDQESRMKAYQICENFKETSPHCVACGALLTDTKHSPVI
RHFGLQLLEHFVRFKWNDATGEQKLQFKNLILEMITKKSTNVLEEENYIKEGLVKIVVEM
IKREWPQQWPSLLEELDQMCQIGDSQTELVLLILLRLVEDVVSFHNVQQSRRRKDLWQAL
TSNMAQISSFLIKVLEMYSEKYQSLETSAPQSNEAKSACKVTQTVLVTLCGFVEWMDAKH
LFKEENRLLIFLYQLLRNEELKMLAAECLQLIVHRKGKIEERKPLMVLFCDVAMTELFNA
AVKACSAGLDEKNHLFVKKLCQVITGLGSQMCAIWAIEGEVFEPPSNLASYLKTLYSFTQ
HASTHVCHLTSASWMAFLRHEHMPRTQAVLEIIPNLCQTYISTSQKIGYPSRNDSPACAY
ARIDFDSDDEFFHFFAAHRYYQLEILRHATGLCPETTFSIAARWLQELLAAPLEREEGKE
LCTNHSPSTIKWDAMSSYLDSVITTLIKKDQLPTQQAIELIQATLNCKIEDPVILSFQLT
CISTLFPVLHHSNQHVEGVLDKLFAAAVYSWPGLTKKTRTRSVQNVRRHACSAMVKMCRD
HQTLMLPHFEKIYTQVKRLCSDPEQLTQLERVTLSEALILINNGLHNWNRQSALIAEIMK
PITEVWLSPHITEIIQSPESFIHNIGLDHPSDAQPNQEDVHNKNRAQIFSCISTSQAVVK
RSCWPSDPQVAAAGGFISGHLPSGAPIYKNPSTPHILPILPNLFTLARTLNAMWSPECRG
KVCPEYTKSYNMTENERNTILGLYGNSTEIPTNKPVVEKVQIFLTVVYETTCHLFADCFQ
SLGYEFFAAEGLSSQLLESIFTNLHHLPDYRLRHIIRVVTKGFVQSCPRECWQSVLVPVM
TGLTSFMVHRLNQQWAIILQRAESGEAREEQNDEQETQEVLEDHLTRTVTKEFMELLGNL
CWSNNRTSSSSVTVKEEGGGGGGGELEMETEEAMEQGEGGAGNSAKSEPATISDLGKVIL
QNERLCESIVTCIYTAMSWPDSGVCMKACRLSWLIVQELATRPLLPEAVTHLYTSILRGL
QIHGEHDTCRAELVYRAMNHYELLREKFPVLTEVMLSLPHCTQPALQKFHEKVPSSKPSE
KKKREAFKSFIQSFIGVPVSQKFKRKEVIRDLPAIFKPMKPKLNVVDASVGAEEAGLVML
FASDADL
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaagagcagacattgcagttgatagatgcagtcaacgtcacaatgaaccca
gtaattgatcaagaaagccgaatgaaagcataccagatttgtgagaacttcaaagaaaca
tcgccccattgtgtagcatgtggagctctgcttactgatacaaagcattcccctgtcatt
aggcattttggactgcagctcctggaacattttgtgagattcaagtggaatgatgcgact
ggggaacagaaactacagttcaagaacctgatactagaaatgatcactaagaagagcacc
aatgtacttgaggaagagaactacatcaaggagggtctggtgaagatcgttgtggagatg
atcaagagagagtggcctcagcaatggcccagcttactggaggagctggaccagatgtgc
caaataggagatagtcagactgaattggttcttctcatcctattgaggctggtagaagat
gtggtttcattccacaatgtccagcagagcagacggcggaaggacctctggcaagccctg
acatccaacatggctcagatctcctctttcctcatcaaggttctggagatgtactctgag
aaataccagtcattggaaacttctgcaccgcagagtaatgaggccaagtctgcatgtaag
gtgacccagacggtccttgtgaccctgtgtggcttcgtagagtggatggacgccaagcat
ctcttcaaggaagagaaccgcctcctcatcttcctctatcaactccttagaaatgaggag
ctgaagatgctggcagcagagtgcttacaactcattgtgcacagaaagggtaagatagaa
gagagaaaaccactgatggtgctgttctgtgatgtagctatgacagaactcttcaatgct
gccgtgaaagcttgcagtgccggcctcgatgaaaagaatcacttatttgtgaagaaattg
tgtcaagttatcacaggcttgggctcacagatgtgtgcaatatgggcaatagaaggagag
gtttttgagccgccatccaatctcgcttcctacctgaagaccctgtacagtttcacccag
catgccagcacacatgtttgtcacctaacttcggctagttggatggcgttcctgaggcac
gagcacatgccacgcacccaggctgtgctagaaattataccaaacctctgtcagacttat
attagcacgtctcagaagattggctacccatctcgtaacgactcccctgcctgtgcttat
gccaggattgattttgactcggatgatgagttctttcatttctttgcagctcatagatac
taccagctggagatcctcagacatgcaacaggtctttgtcccgagactactttcagcata
gctgctcgttggttgcaggagcttttagctgctccccttgagagagaggaaggcaaagaa
ctgtgcaccaatcactctccatcaaccatcaaatgggacgccatgtctagttaccttgac
agcgtaataacaaccctcatcaagaaagaccagctaccaacacagcaggccatagaactg
atacaagcaactctcaactgtaaaatagaggacccagtgattctgtctttccagctgacc
tgtatatcaacactatttccggtacttcaccattccaaccaacatgtagaaggtgtcctg
gataagctctttgctgctgctgtgtactcgtggcctggtctgactaagaagacaaggact
cgatccgttcagaacgtcagacgacacgcttgctcagctatggtcaagatgtgcagagat
catcaaacactcatgctgccccattttgagaagatctacacccaagtaaagaggctgtgc
tctgatccagagcagctgacccagctagagagggtcacactcagcgaggctctcattctc
atcaacaacggactccataactggaaccgtcagagtgccctcattgccgagattatgaaa
cccatcacagaggtctggctgtctccacatatcacagaaattatccaatctccggagtct
ttcatccacaacattggtcttgaccatccaagcgatgctcagccaaaccaggaggatgtc
cacaacaagaatcgtgctcagatcttcagctgtatctcaaccagccaggctgtcgtcaag
agaagctgctggccctcagacccacaggtggctgcagctggaggatttatcagtggccat
ctcccaagcggtgcaccgatctacaagaatcctagtactcctcacatcttgcctatcttg
ccaaacctcttcacgcttgccagaaccttgaacgctatgtggtctcctgaatgcagaggg
aaggtgtgtccagagtatactaaatcatacaacatgactgagaatgagaggaatactatc
ctaggtttatatgggaacagcaccgagataccaaccaacaaaccagtcgtggagaaggtc
caaatcttcctcactgttgtctatgaaactacatgtcacctgttcgctgactgtttccag
agtcttggttatgagttcttcgctgccgagggtctgtccagtcaacttctcgaatctatt
ttcaccaaccttcaccatctaccagattacaggctccggcacatcattcgtgtggtgacc
aagggcttcgtgcaatcctgtcccagggaatgctggcagtcggtcctggtcccggtgatg
actggtctaacttcgttcatggtccatagactgaaccagcaatgggccatcattttacag
agggcagaatctggtgaagcgagggaggaacaaaatgatgaacaagaaacacaagaggtc
ctggaagatcatctaacgagaacagtcaccaaggaattcatggagttattaggaaatcta
tgttggagcaacaacaggacatcgtccagtagtgttacagtgaaggaggagggaggaggc
ggcggtggaggagagttagagatggagacagaagaagccatggaacagggagagggtggg
gcagggaacagtgcaaagtcagaacctgctactatcagtgacctcggaaaggtcatctta
cagaacgagagactatgtgagagcatcgtaacctgtatatatacagcaatgtcctggcct
gacagtggtgtttgcatgaaggcatgtcgtctctcatggctcattgtgcaagagctagcg
accaggcctctcttacctgaagcagtcacccatctctacacgtctatccttagggggcta
cagatacacggagagcacgacacatgtcgcgcagaactcgtctacagagcaatgaaccac
tatgaactattgagagagaagttcccagtcctaactgaagtgatgttgagtttaccacac
tgcactcagccagcattgcagaagttccatgagaaagtcccgagctccaagccatctgag
aagaagaagagagaggccttcaagagctttatccagagcttcatcggggtacctgtgagt
cagaagttcaagagaaaggaggtgattcgtgaccttccagcaatcttcaagcccatgaaa
ccaaagcttaatgttgtggatgcatcagtaggagcagaggaggcaggtctagtcatgctt
tttgccagtgatgcagatttatga

DBGET integrated database retrieval system