KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592274Help
Entry
592274            CDS       T01019                                 

Definition
(RefSeq) probable cysteine--tRNA ligase, mitochondrial
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    592274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spu01007]
    592274
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spu03016]
    592274
Enzymes [BR:spu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     592274
Amino acid related enzymes [BR:spu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   592274
Transfer RNA biogenesis [BR:spu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    592274
 Prokaryotic Type
    592274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DALR_2 Metal_CEHH
Motif
Other DBs
NCBI-GeneID: 592274
NCBI-ProteinID: XP_011669091
Position
Un
AA seq 599 aa AA seqDB search
MGLRVITTDFAFGRHGRMSNLYKQCRTLFWRRDVCTSSSSMSAPVRYPVQKDGRTTVHVL
NSLTAAHDRKSAKKEPLLLMNKNVATWFACGPTVYDSAHIGHASSYVRFDIIRRILAEFF
QTSVVMVMGITDIDDKIIRRSHEQNLKDFRELAGFYEREFYQDMQHLNVLPATVYTRVSD
HIPEILTFIDSIIKNGYGYSTSSGSVYFNVDAFTLERYDKLASQDLDVQHDEGKEFIDPE
KRHPRDFALWKGVKPGEPWWDAPWGKGRPGWHIECSAMSKAIFGERLDIHTGGRDLAFPH
HNNEIAQCEACFNSNQWANYFLHSGHLYRKYDADKMSKSLQNVVSIQDFLKTYTPNQFRF
LCLMSKYDHDLEYGPDTMQQAVVLHRQMSAFLNDADAYVKGQICCKPFNEAELMQRLETT
REEVIEALADDFDTKRALDCIMKLAHTCNSNFSQVSEETSGRSPGAVAAVATYINQVLSN
LGLHMSTRSSTQLDQSSQAMTVALDTLVNFRQDVRRWALTDQEDHGISSVSQSSHGDSDD
VRQKRRKLMKERAPLLNACDHVRDTLTQNGIQIKDRGATATWEFVEKQKPVKTEDETDR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgagagttattacaactgactttgcatttggcagacatggtagaatgtctaat
ttatataaacaatgtaggactctgttttggagaagagatgtgtgtacatcatcatcatct
atgagtgccccagtgaggtatccagtgcagaaggatggaaggactactgttcatgtcttg
aattcattaacagcagcacatgatagaaaaagtgcaaagaaggagcctctcttattgatg
aacaaaaatgtggcaacatggtttgcctgtggtcctacagtttatgattctgcccatatt
gggcatgcaagttcctacgtgagatttgatatcatccgccgtatcttggcagagttcttc
cagacgagcgttgtcatggtgatgggtattactgacatcgatgataagatcataagacga
tctcatgaacagaatttaaaggacttcagagaattagccggattctacgaaagagaattt
tatcaagatatgcaacacctcaatgtcttaccagctactgtgtatacccgggtatctgat
catataccagagattcttactttcattgatagtatcatcaaaaatggctatggatattct
acaagcagtggtagtgtgtatttcaatgtggatgcgttcaccctagagagatatgacaaa
ctagccagtcaagacttagacgtccagcatgatgaaggcaaagagttcattgacccagag
aagagacatccaagggactttgctctgtggaagggggtcaaaccaggagaaccatggtgg
gatgcaccatgggggaaagggagaccaggatggcatattgaatgctcagctatgtccaag
gctatctttggtgagagattggatattcatactggtggaagagatctagccttccctcat
cacaacaatgagattgcgcaatgtgaagcttgcttcaactcaaatcaatgggctaattac
ttcctgcattcaggtcatctttacaggaaatatgatgctgataagatgtctaagtcactt
cagaatgttgttagcatccaggacttcttgaagacctatacaccaaaccagttcagattt
ctgtgtcttatgtccaagtatgatcatgatttagagtatggtccagacacgatgcagcaa
gccgtggtgctacatagacagatgtcagctttcctcaatgatgctgatgcctatgtcaaa
ggtcaaatatgctgtaaaccattcaatgaagcagaactcatgcaaaggttagagacgact
cgagaggaggtcattgaggcattagctgatgattttgatacaaagagggcactagactgc
atcatgaagctggctcatacatgtaactcgaatttcagccaagtgtcagaggagacatct
ggtcgcagccctggagcagtagcagcagtagctacatatatcaaccaagtcttatctaac
ttaggattacacatgtctacaagatcaagcacccagttagaccagtcatcacaagcaatg
accgttgctctagacacattggtcaacttcagacaggatgtccgtcgatgggctcttact
gaccaagaggatcatgggatatctagtgttagtcagagcagccatggagattcagatgat
gtgagacagaaaaggagaaagctgatgaaagaaagagctccattgcttaatgcttgtgat
catgttagagatacccttactcagaatggcatacagattaaggatcgaggagctacagcc
acgtgggagtttgttgagaagcagaaaccagtgaaaacggaggacgagaccgacagatga

DBGET integrated database retrieval system