KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592425Help
Entry
592425            CDS       T01019                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00511  Other glycan degradation
spu00600  Sphingolipid metabolism
spu01100  Metabolic pathways
spu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    592425
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    592425
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    592425
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     592425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 592425
NCBI-ProteinID: XP_011672266
UniProt: W4YPC5
Position
Un
AA seq 522 aa AA seqDB search
MDTGRVLTILAFVAVVCATDNDCKFRQFSDTSSFVCECSAGHCDVIEEYSLSDENFVVYT
SGKRGFRLDKEEMPIRNRPTPNVPDTSITITVDRNEEYQTILGFGGSFSDSAALNLYNLS
SDTQDKLLRAYFSSDGIEYSFGRVPIASCDFSTREYSYAETPDDFNLDDFQLAFEDIDYK
IPMIQRASAMSSRPIKLLGSAWSAPGWMKTNGAMKGGGALRGLPGGYYYKTWALYLAKFL
EAYSAYDVDFWGLTTGNEPTAGLFPGWDWQCMFFNPELQRDFIKLDMGPILHDRGHKDVE
IVIMDDQRFHLPHWAEVVIEDPVASQFVSGIGLHWYTDFLIDASRLNETHHAYPDYFMIN
TEACEGYLPWQEKVILGSWERGESYSHDIIEDLSNWVGGWIDWNMALDMIGGPNWVGNFV
DSPIIVNAEEDVFYKQPMYYHLGHFSKFIAPGSVRVGSSSDRDRLVEHLAFKLPDGDMAL
VVLNRKEFTFPLHIYDPDVGYLNAEVPSRSIQTYLWKSPSRL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggatacagggagagttctaacgattcttgcttttgtagctgtggtctgcgcaacagat
aacgactgcaagtttcgtcaattttccgacacgagttctttcgtctgtgagtgctctgct
gggcactgtgacgttatcgaggaatactccctcagcgatgaaaactttgtagtgtatact
tctggaaaaagagggtttagattggacaaagaggagatgccaatcagaaatcgaccaact
cctaatgtcccagatacaagtatcaccatcacagttgatcgaaatgaagagtatcagacc
atccttggttttggcgggtctttctcggactcagcagctctcaatctctacaacctatcg
tctgatacacaggacaaactgctgagggcgtacttctcatccgatggaattgaatactca
tttggtcgtgtaccgatcgcgagctgcgatttttcaacaagggaatactcgtatgccgaa
acaccggatgacttcaatcttgatgatttccaactcgcctttgaagacattgattacaag
atcccgatgatacagcgagcctcagccatgagttctagacccatcaagttgttaggcagt
gcctggtctgccccagggtggatgaagacaaacggtgccatgaaaggaggtggtgcactc
agagggctgcctggagggtactattacaaaacatgggctctctaccttgccaaattcctc
gaagcctacagtgcctatgatgtggacttctggggtctaacaacaggcaacgaacctacg
gcaggtctcttcccaggttgggactggcagtgcatgttcttcaatcctgaactacagagg
gacttcatcaagctcgacatgggtcctatcttacacgacagaggccataaagacgtcgag
atcgtcatcatggatgatcaaaggttccatcttcctcactgggctgaagtggtcatcgaa
gacccggtggcctctcaattcgtttctggtatcggcctccactggtacacggacttcctc
atagatgccagtcgtctcaacgaaacacaccacgcttatccagactacttcatgatcaat
acagaggcgtgtgaggggtacttgccgtggcaggagaaagtgattcttggtagctgggag
agaggtgaatcctacagccatgatatcattgaggacctgagtaactgggtcggtggatgg
atcgattggaacatggctctagacatgatcggaggaccgaactgggtggggaacttcgtt
gatagtcctatcattgtcaacgctgaagaagacgtgttctacaagcaaccgatgtactac
caccttggacacttcagtaagttcatcgcccctggatcggtgagggtggggtcatctagt
gatcgtgacaggttggttgagcatctagcattcaagctcccggatggtgacatggcactt
gtcgtcttaaacaggaaggagtttacgttccctcttcacatctatgacccggatgtcggt
tacctgaatgccgaggttccatctcgctccattcaaacatatctatggaaatcaccatct
cgcctataa

DBGET integrated database retrieval system