KEGG   Strongylocentrotus purpuratus (purple sea urchin): 593793
Entry
593793            CDS       T01019                                 
Name
(RefSeq) CD63 antigen isoform X1
  KO
K06497  CD63 antigen
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    593793
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spu04147]
    593793
   04090 CD molecules [BR:spu04090]
    593793
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   593793
CD molecules [BR:spu04090]
 Proteins
  593793
SSDB
Motif
Pfam: Tetraspanin AA_permease_2 Adeno_E3_CR2
Other DBs
NCBI-GeneID: 593793
NCBI-ProteinID: XP_030829577
Position
Unknown
AA seq 248 aa
MVEGTASCIKYLMFIFNFIFFIFGLGIIVGGSLTLTLYSEYVDFTGNTGTAIPIALICIG
VFIFLTGFFGCCGAVKENYCMLGTYAFIMVLLLILELAAGISGYVLRDDIDKLVDDNMTD
LQKEYNSSTSTQQLFDNMQKNLECCGRNNYTEWFGFNVNKTSGINNNMVPMSCCIIQEDG
CNMDVSSDPYVAGQNIYVSPCYNALKDLLLRNIGIIAGVAIGIAVIEIFGIAFGCCLMRK
IKNEYETV
NT seq 747 nt   +upstreamnt  +downstreamnt
atggtggaaggaacagcatcatgcatcaaatatttgatgttcatcttcaacttcattttt
ttcatctttggtcttggtatcatcgttggaggaagtctgacattgactctctacagtgag
tatgtagacttcactggtaatacaggcacagctatacctatagctctcatctgtattggt
gtcttcatattcctgactggattctttggatgctgcggagcagtcaaggagaactactgc
atgctgggaacgtatgctttcatcatggtccttcttctaatcttggagcttgctgctggt
atctctggctatgtccttcgtgatgacattgataagctggtcgatgacaacatgactgac
cttcagaaagagtataactcatctacttcaacgcaacaactctttgataacatgcagaag
aatttggagtgttgtgggagaaacaactacacagagtggttcggcttcaatgttaataag
acgagcggaataaacaacaacatggtaccaatgtcatgctgcattatacaagaagatggc
tgtaacatggatgtgtcctctgatccatatgtagcaggacaaaatatttatgtatcccct
tgctacaatgcactcaaagatcttctgcttcgtaacattggaattattgctggagtagcc
atcggcattgctgtcatcgagatctttggtattgcgtttgggtgctgtctgatgagaaag
atcaagaatgaatacgagacagtttaa

DBGET integrated database retrieval system