KEGG   Strongylocentrotus purpuratus (purple sea urchin): 593856Help
Entry
593856            CDS       T01019                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme, mitochondrial isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00564  Glycerophospholipid metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    593856
Enzymes [BR:spu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     593856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 593856
NCBI-ProteinID: XP_798408
UniProt: W4ZK43
Position
Unknown
AA seq 424 aa AA seqDB search
MEVLVLLGHIPAFLSIFLTVQAWYFIYVNFLPFVGQLPYLKRVNPYKACLRIGYILLPWC
EFLDVKIRVPDSAEDEDIDLGDHEESHTSFKNKDGLIDSDLDYAEEQIAAYRNFFVNLYR
ILPFRSLSRLWGRVNSLEVPLFLRAPMYSLYVRLFNCNLSEALVEDLKQYRNLQDFFMRE
LKPDVRPVDAHHMLVSPCDGRVLHFGKVEKSKLEQVKGITYSLKDFLGPNSTNSDTVGNE
YEVSDEDYHSSLCQKEGTSLYHCVIYLAPGDYHRFHSPTDWTAHHRRHFPGELLSVNPGI
ARWVRGLFNFNERVCITGDWQHGFFSFTAVGATNVGSISFYCDEELCTNLTGKCKPGAYY
DKSLKSCRKERGDHDDGVAMTKGTGIGSFNLGSTIVLVFEAPKDFNFVFNSGDKIRLGER
LGSL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcctcgttcttcttggacatattccggcattccttagtatattcctcaccgtg
caggcatggtatttcatatatgtgaattttctaccttttgttggacaattaccataccta
aaacgtgtgaatccatacaaagcttgtctacgaattggatacattttgttgccatggtgt
gaatttttggacgttaagattcgagtcccagactcggcagaagatgaagatattgatttg
ggagatcatgaagaatcacatactagtttcaagaacaaggatggtttaatagacagtgat
ctggattatgcagaggagcagatcgcagcttacaggaatttctttgtcaacttgtaccgc
atcttaccattccgctcattatcgaggttatggggtcgggtgaatagtttggaggtaccg
ctctttctccgggctcccatgtacagtctctatgtacggcttttcaactgtaaccttagt
gaggctctggtagaagatctcaagcagtacagaaatctgcaggattttttcatgcgagaa
ctcaagccagatgtaagaccagtggatgcacatcatatgctggtcagcccatgtgatggt
agagtcctccattttggtaaagtagagaagagcaagctggagcaagtcaaaggcatcacc
tattccctcaaggacttcctaggaccaaactctaccaactcggatactgtaggcaatgaa
tatgaggtttccgatgaggattatcattcttccctttgtcagaaggaaggtaccagtctg
tatcactgtgtgatctacctggcccctggagactaccacaggttccactcaccaacagac
tggactgcacatcatagaaggcacttcccaggtgaactgctgtctgttaaccctggcatc
gctagatgggtgagaggcctattcaactttaatgagagagtgtgtatcacaggagactgg
cagcacggcttcttctctttcactgccgtgggcgccaccaatgtaggatccatctccttt
tactgtgacgaggagctgtgcacaaacctaacagggaagtgcaagcctggcgcctactac
gacaaaagtttgaagtcatgccggaaagagagaggtgatcacgacgacggtgtggcgatg
accaaagggacgggtataggtagctttaacctcggttcaaccatcgtccttgtctttgaa
gcacctaaagactttaactttgtattcaacagtggggataagatcaggctaggggagaga
ctaggttccctctga

DBGET integrated database retrieval system