KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594037Help
Entry
594037            CDS       T01019                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00450  Selenocompound metabolism
spu00970  Aminoacyl-tRNA biosynthesis
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    594037
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    594037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spu01007]
    594037
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spu03016]
    594037
Enzymes [BR:spu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     594037
Amino acid related enzymes [BR:spu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   594037
Transfer RNA biogenesis [BR:spu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    594037
 Prokaryotic type
   Other AARSs
    594037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C Anticodon_1 GST_C_3 GST_C_2 GST_N GST_C_6 Tom37
Motif
Other DBs
NCBI-GeneID: 594037
NCBI-ProteinID: XP_030838762
Position
Unknown
AA seq 926 aa AA seqDB search
MKIYSDPGNQHTLKAVVAAALANLKLEIQFTSITDSKVPYLKRGKLPVLEISPNEYIFSA
NNICRYILSNGSEQTWELKVEEWVEWESTHLQALLAPYLTAVFGGGKKNAEPFKLPFCKL
NDVLANKQYLVGTSLTAADIVVWCALYPAITDNPSLCADYKHLQCWFQGLASQESFQKGV
ATVTSGKGASAFKEAILSQHVKVPLSDAGRERGQQAAISQASDGQDESKKDIPPEEIAAA
KAAFTRGKKSLPKLTKRVHPVLPQSSGKNILITSALPYVNNVPHLGTIIGCVLSGDVFSR
FCRLRNYNTLYICGTDEYGTATETKALEEGLTPQQICDKYHALHRDIYKWFNIDFDHFGR
TTTQKQTEIAQDIFHRLHAAGHILEDTVEQLQCQKCNRFLADRFVEGICPLCSYEDARGD
QCDKCGKLINATDLKQPRCKVCSNTPVIKTSRHLFLDLPKLAPALEVFLKKSTTEGNWSA
NAKLITNSWVRDGLKPRCITRDLKWGTPVPLKGYTDKVFYVWYDAPIGYPSITANYTDQW
EKWWKNPQQVQLYNFMAKDNVPFHSVIFPSCLIGANDNYTMVNHLIATEYLNYEDTKFSK
SRGIGVFGDNAQSTGIPADIWRFYLLYIRPETQDSAFSWADFVWKNNSELLNNLGNFINR
GLTFLENSFGSVIPEIRLESEDERLIAEINRELKSYIALQEKVKIRDALKHILNISRLGN
QHIQACKPWVLVKGNPQEKLRAGTVIGLAANISCLLSVILQPFMPETSATIQAQLQAPAE
CYVLVEEFVCYLDKGHKIGKPSPLFSKIEPAQAEEFKKRFAGKQQKVESAAKPSAAATPA
PPTSNPPTSNQATPASPQEIERLTAQVTAQGEKVRKVKGEKADKAVVDAEVKALLDLKRQ
LAIASGLDPDAASKSKGKSKKKGGKK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatattctgatccaggaaatcaacatactctaaaagcagtagttgctgctgct
ttagctaatctgaagctagagattcaatttacgagtattacagattccaaggtgccatac
ttgaagaggggcaaacttccagttcttgagatatcaccaaatgagtacatcttttcagca
aacaacatctgcaggtatatcctgtccaacggctctgagcaaacttgggagttgaaagtt
gaggagtgggtcgagtgggagagtactcacttacaggctttgctagccccttacttaact
gctgtctttggaggcggaaagaagaatgcagagccatttaagcttccattctgcaaatta
aatgatgtgctggccaataaacaatatttagtggggacaagcctgaccgcagctgacatt
gtggtatggtgtgccctgtacccagccattaccgacaacccaagcctttgtgctgactac
aagcaccttcaatgctggttccagggccttgcatcccaagagagctttcagaagggtgtt
gctaccgtgacatcagggaagggtgcaagtgccttcaaggaagccatcttgtctcagcat
gtcaaggttccgctgtctgatgccggtcgtgagagaggacaacaggcagctattagtcag
gcttcagatggacaggatgagagcaaaaaggacattccacctgaagagatagctgcggct
aaggcagctttcaccagaggaaaaaagtcattacctaaattgaccaagagagttcatcca
gtactacctcaatcttccgggaagaacatcctcatcaccagcgctcttccgtatgtgaac
aatgtacctcacctaggaaccatcatagggtgcgttctcagtggggatgtcttctcaaga
ttctgtcgtctcaggaactacaacaccctgtacatctgtggtacagatgagtatgggact
gctactgaaaccaaggcattagaagaaggcttgactcctcagcagatctgtgacaaatac
catgcacttcatcgagacatctacaaatggtttaatattgactttgaccactttggtaga
accaccacccaaaagcagactgagattgctcaggacatcttccaccgtctgcatgcggct
ggtcatattctagaggatacggtagaacagctccagtgtcagaagtgcaaccgctttcta
gctgatcgctttgttgaaggaatctgtccactctgtagttatgaggatgctagaggagac
cagtgtgataaatgcggaaagctcatcaatgcaacggaccttaaacaacctagatgtaaa
gtctgcagtaacacccctgtcatcaagacttccaggcatctgttcttagaccttcccaag
ctagcaccagcacttgaggtgttcttaaagaagtctacaaccgaaggcaactggtctgcc
aatgctaagctcattacaaactcatgggtgagggatggactgaagccacgatgtatcact
cgggatctgaagtggggcacacctgttccactgaaaggatacacagataaggtgttctat
gtatggtatgatgctcctattggctatccgtccatcacagcaaattacacagaccagtgg
gagaaatggtggaaaaacccacagcaggtccaactatacaacttcatggcgaaagacaat
gtgccattccacagtgtgatattcccaagctgtttgattggggctaatgataactacacc
atggtcaatcatcttatagccacagaatacctgaactatgaggacaccaagttttccaag
agtcgtggcatcggtgtgtttggtgacaacgctcaatcaaccggtatcccagcagacatc
tggcgtttctatctcctctacatcagacccgagacccaggacagtgccttcagctgggct
gactttgtctggaagaataacagtgagcttctcaacaacctgggcaacttcatcaacaga
ggcttaacattcctggagaatagttttggcagtgtaatacccgagataagattggagagt
gaagatgagaggctgattgctgagatcaacagagaactcaagagctacattgcattacag
gagaaggtcaaaatccgtgatgccttgaagcacatcctcaacatatctcgtcttggtaat
caacatattcaagcatgcaagccatgggtgctagtcaaaggcaatcctcaagaaaaactc
cgggctggtactgtgattggtctggcagcaaacatctcctgcctcctctcggtcattctg
caaccattcatgccagagacgagtgctaccatccaagctcagctccaggctcctgctgaa
tgttacgtgctggtggaagaatttgtttgttacctggacaagggtcacaagataggcaag
ccaagtccactcttctccaagattgaaccagcccaagctgaagaattcaagaagagattc
gcaggcaaacagcaaaaggttgaaagtgctgcaaagcctagtgcagcggccaccccagcc
ccacctacatcaaacccacctacaagcaaccaagccactccagcaagccctcaggagata
gagagactcactgcacaagttacagctcagggagagaaagttcgtaaggtgaagggtgag
aaggctgacaaggcagtagtggatgcagaggtcaaggcattgctggacttgaaacgtcag
ctagccattgcatctggtctggatcctgatgctgcatccaagtctaagggaaagagtaaa
aagaaagggggcaaaaagtag

DBGET integrated database retrieval system