KEGG   Strongylocentrotus purpuratus (purple sea urchin): 594130
Entry
594130            CDS       T01019                                 

Definition
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00130  Ubiquinone and other terpenoid-quinone biosynthesis
spu00350  Tyrosine metabolism
spu00360  Phenylalanine metabolism
spu01100  Metabolic pathways
spu01240  Biosynthesis of cofactors
Module
spu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    594130
   00360 Phenylalanine metabolism
    594130
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    594130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spu04147]
    594130
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     594130
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   594130
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_5 Glyoxalase_3 HTH_11 DGF-1_5
Other DBs
NCBI-GeneID: 594130
NCBI-ProteinID: XP_798672
UniProt: W4XXN2
Position
Unknown
AA seq 386 aa
MTTYTDKGPKPDAGRFVAFDHISFWVGNALQAATFYCVRMGFEPFAYRGLQTGSRQVCTH
VVRQGKIMFALHSPLNPSGDVTEEMGKHMQLHGDGAKDIAFEVKDLAGVVETAVKRGAIL
LKEPWEESDDNGTVKFAQIQTYGDTVHTFVERGGYTGLFLPGYKKPLYSDPLLATLPKVN
LNFIDHIVGNQPDNEMVSIADWYEKNLMFHRFWSVDDSQIHTEYSALRSIVVTNYEETIK
MPINEPADGKRKSQIQEYVDYYGSAGVQHIALNTSDIIGTIKALKARGMNFLSIPDTYYT
NLKERLKLSKVTVTEDLDTIQKLQILIDYDDNGYLLQIFTKPIQDRPTVFLECIQRKNHQ
GFGAGNFKSLFEAIEMDQADRGNLIK
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacaacctacacagacaaaggaccgaagccggatgctggccggttcgttgcattcgat
catatttctttttgggtcggcaatgccctccaagctgcaaccttttactgtgtgcgtatg
ggttttgaacccttcgcctacaggggcctgcaaacaggaagtcgacaagtctgtacccat
gttgtccgccaagggaagatcatgtttgctcttcattcgcccttgaatccttcgggtgat
gtcactgaagaaatgggaaaacacatgcaattacatggggatggagcaaaggatattgcc
tttgaagtgaaagatctggctggtgttgtggagactgctgttaagagaggggccattttg
ctgaaagagccgtgggaagaatccgatgataacgggacggtcaaatttgctcagatacag
acgtacggtgacactgttcatacatttgtggagagaggtgggtatactggactcttttta
ccagggtacaagaaaccactctattcggatcctctccttgccacactgccaaaggtcaac
ctgaacttcatcgatcatatagttggtaatcagcctgataatgagatggtcagcatagca
gactggtacgagaagaatctgatgttccatcgcttctggtcagttgacgattcccagatt
cacactgagtatagcgccctcaggtctattgtggtgaccaactatgaagagacgatcaag
atgcccatcaatgagcccgctgatggcaagagaaaaagccagatccaggaatacgttgat
tactacggttcagccggggtacagcacattgccctcaacacgtccgacatcatcgggacc
atcaaagctctgaaggctcgaggaatgaatttcctgagcatcccggacacctactacaca
aacctgaaggaaagactcaagctatcaaaagtaacagtcactgaagaccttgatacgatt
cagaagctccagatcttgattgattatgatgataatggctacctgcttcagatcttcacc
aaaccaatccaagatcggccgacagtcttcctggagtgcattcaacgaaagaaccatcag
ggatttggtgcaggtaatttcaagtccttgttcgaggccatcgagatggaccaagccgac
agaggaaacttgatcaagtaa

DBGET integrated database retrieval system