KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754396Help
Entry
754396            CDS       T01019                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00051  Fructose and mannose metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    754396
Enzymes [BR:spu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     754396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Glu_synthase
Motif
Other DBs
NCBI-GeneID: 754396
NCBI-ProteinID: XP_030838759
Position
Unknown
AA seq 446 aa AA seqDB search
MAVNTKIVNIEVKDIRFPTSLEGHGSDAMHTDPDYSCAYVIIRTDAGDGLEGHGPTFTIG
RGTEVVVAGVKALIPFVVGLKVADIFGDFATFWRKLTSESQLRWIGPEKGVISLATCAVL
NALWDLWAKMAGKPLWKLLVDMTPEQLLSVIDFRYITDALTKEEALQILKANESTKAERE
AELMKNGFPAYTTSTAWLGYSDETLRERCKAALKDGWTWFKMKIGANLEDDIRRAKIIRS
EIGDDKVLMMDCNQRWEVSQAIDWMKRLAEFKPYWIEEPISPDDVLGHAAISKALNPLGI
KVATGEQCQNRVMFKQFLQAKALQILQIDSCRIGGINEVLSVILMARKFGVPVCPHAGGV
LLCELVHHLSMFDYVCVSGTKEGRVIEYVDHLREHFKYPSIIKNASYMPQKIPGYSTELK
KASLEDYVYPEGRIWQQLAKEGKVKL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaacactaaaattgtcaacattgaagtgaaagatattcgttttccaacctca
ctcgagggccatggatcggatgctatgcatactgatcccgactattcctgtgcgtatgtc
atcatcagaactgatgctggagatggattggaaggtcatggaccaacgtttaccatcggc
aggggaacggaagttgttgtggcaggagtaaaggctctcattccctttgtggtcggtctc
aaggtggcggacatctttggcgattttgcgacgttctggcggaaactgacgagcgaatca
cagcttagatggattggacctgagaaaggagtcatctctctagcgacatgtgctgttctg
aatgctctctgggacctatgggccaagatggctggaaagcctctttggaagttgcttgta
gatatgaccccagagcaactgttaagtgttatagacttcagatacataactgatgcactg
acaaaagaagaggctttgcagattctaaaagctaacgaatcaacgaaagctgaaagagaa
gctgagttgatgaagaatggctttccagcgtacaccacctcgactgcttggttaggatac
tctgacgaaacacttagagagaggtgtaaggctgccttgaaggacggctggacttggttt
aagatgaagataggagctaatctggaggatgatatcagaagagctaagatcatcagatca
gagattggagatgacaaagtattgatgatggactgtaatcagagatgggaggtatcccaa
gctattgactggatgaagagactagctgaattcaagccttactggatagaggaacccatc
tcacccgacgatgttctaggtcatgctgctatctccaaggctcttaatccgttgggcatc
aaggtagccacgggagagcagtgccagaatcgtgttatgttcaagcagtttctccaagcc
aaagccttacagatcctgcagatcgatagctgccgaatcggagggatcaacgaagtcctc
tctgttatcctcatggcaagaaaatttggagtacctgtttgtcctcatgcaggtggagtg
ctgctctgtgagctggtacatcatctcagtatgtttgactatgtgtgtgtatcaggaact
aaggagggaagggtgattgagtatgtggaccatctgagggagcacttcaagtatccctca
atcatcaagaatgcttcatacatgccacagaagattcctgggtactcgacagagctcaag
aaagcaagcttagaagactacgtctacccggagggtcggatatggcagcaactcgcaaag
gaaggcaaggtcaagttgtaa

DBGET integrated database retrieval system