KEGG   Strongylocentrotus purpuratus (purple sea urchin): 764126Help
Entry
764126            CDS       T01019                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00350  Tyrosine metabolism
spu00360  Phenylalanine metabolism
spu00380  Tryptophan metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    764126
   00360 Phenylalanine metabolism
    764126
   00380 Tryptophan metabolism
    764126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spu04147]
    764126
Enzymes [BR:spu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     764126
    4.1.1.105  L-tryptophan decarboxylase
     764126
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   764126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 764126
NCBI-ProteinID: XP_011678447
Position
Un
AA seq 239 aa AA seqDB search
MTTSDDFRVWGKEMVDYISRYQDGIEDRPALAQVAPGYLLDQMPADAPQKPDEWNDVMAD
VERLIMPGVTQWNHPNFHAYFPTANSFASLLGDMLSGAIACVGFSWITSPACTELEMAMM
NWLGRMLNLPESFLFNETRQGGGVIQGSASEATLVALLAAKMKTIRQKIEEDPSLDQYDV
MSKLVVYTSDQSHSSVERAALIASLRIRQLATDDKGSLRGDVLQKAIEEDKAKGRIPVY
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctccgatgatttccgtgtctggggcaaggagatggtggactacatctcacgt
taccaggacggtatcgaggaccgaccagcccttgcccaagtagccccgggctacctgctg
gatcagatgcccgccgatgcccctcagaagcccgatgagtggaatgacgtgatggctgat
gtggagaggctgattatgccaggggtaacgcagtggaatcatcccaatttccacgcctac
ttccccacagcaaactccttcgcttctctattaggtgatatgttatcaggtgctatcgcc
tgtgtcgggttttcatggataaccagtccagcatgtacggagctcgagatggctatgatg
aattggttgggaaggatgttgaatcttcctgaatcatttttattcaatgaaacaaggcag
ggaggaggagtcattcagggttcagcaagtgaagcaactctagtagccttgctggcagct
aagatgaagacaataagacagaagatagaagaggatccgagtcttgatcagtatgacgtc
atgtcaaaactagtcgtttacacatcagaccagagccattcatcagtcgaacgagcagct
ttgattgctagtcttcgcatcagacagctggccaccgatgacaaaggttctctgagaggg
gatgtactccagaaagccatagaagaagacaaagccaaagggagaatccctgtttac

DBGET integrated database retrieval system