KEGG   Streptomyces puniciscabiei: BFF78_15850Help
Entry
BFF78_15850       CDS       T05140                                 

Definition
(GenBank) fructose-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00010  Glycolysis / Gluconeogenesis
spun00030  Pentose phosphate pathway
spun00051  Fructose and mannose metabolism
spun00680  Methane metabolism
spun01100  Metabolic pathways
spun01110  Biosynthesis of secondary metabolites
spun01120  Microbial metabolism in diverse environments
spun01130  Biosynthesis of antibiotics
spun01200  Carbon metabolism
Module
spun_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFF78_15850
   00030 Pentose phosphate pathway
    BFF78_15850
   00051 Fructose and mannose metabolism
    BFF78_15850
  09102 Energy metabolism
   00680 Methane metabolism
    BFF78_15850
Enzymes [BR:spun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BFF78_15850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AOR32345
UniProt: A0A1D7Y9P0
Position
3868994..3870028
Genome map
AA seq 344 aa AA seqDB search
MTENHHLPSELDVPSEAPDRNLALELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTL
VSTVSMNGVVVIGEGEKDEAPMLFNGEHVGDGTGPEVDIAVDPIDGTTLTAKGMPNAIAV
LAAAERGAMFDPSAVFYMDKLVTGPEAAEFVDIDAPVAVNIKRIAKAKKATPEDVTVVIL
DRPRHEGLIREVREAGARIKLISDGDVAGSVYALREGTGVDLLLGIGGTPEGIISACAVK
CLGGTIQGKLWPKDDEERARAIDAGHDLDRVLTTDDLVSGENVFFVATGITDGELLRGVQ
YRSEKALTESIVMRSKSGTVRRIYSEHRLSKLRAYSAIDFDRAK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaatcatcacttgccgtccgagcttgatgttccttccgaggctcccgatcgc
aacctcgccctggagctcgtccgggtcaccgaagccgcggcgatggccgcgggccgctgg
gtggggcgcggcgacaagaacggcgccgacggtgccgcggtgcgcgccatgcggaccctc
gtctccaccgtgtcgatgaacggcgtcgtcgtcatcggcgagggcgagaaggacgaggcc
ccgatgctcttcaacggggagcacgtgggcgacggcaccggtcccgaggtcgacatcgcg
gtcgaccccatcgacggcaccacgctgacggccaagggcatgccgaacgcgatcgccgtc
ctcgccgcggccgagcggggcgccatgttcgacccgtccgccgtgttctacatggacaag
ctggtcaccggcccggaggccgccgagttcgtcgacatcgacgcgcccgtggccgtgaac
atcaagcgcatcgccaaggcgaagaaggcgacgcctgaggacgtcaccgtcgtcatcctc
gaccggccgcggcacgagggcctgatccgggaggtccgggaggccggcgcacggatcaag
ctgatctccgacggcgacgtggccggctccgtctacgcgctgcgtgagggcaccggggtc
gacctgctgctcggcatcggcggtacgccggagggcatcatctcggcctgcgccgtgaag
tgcctgggcgggacgatccagggcaagctgtggcccaaggacgacgaggagcgcgcgcgg
gccattgacgccgggcacgacctggaccgtgtgctgacgaccgacgacctggtgtccggg
gagaacgtgttcttcgtcgcgaccgggatcaccgacggtgagctgctgcggggtgttcag
taccggtcggagaaggcgctgaccgagtcgatcgtgatgcggtcgaagtcggggacggta
cggaggatttactccgagcaccggctgagcaagctgcgggcctacagcgcgatcgatttc
gaccgcgccaagtag

DBGET integrated database retrieval system