KEGG   Streptomyces puniciscabiei: BFF78_29620Help
Entry
BFF78_29620       CDS       T05140                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00860  Porphyrin and chlorophyll metabolism
spun01100  Metabolic pathways
spun03030  DNA replication
Module
spun_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BFF78_29620
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BFF78_29620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spun03032]
    BFF78_29620
Enzymes [BR:spun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BFF78_29620
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     BFF78_29620
DNA replication proteins [BR:spun03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     BFF78_29620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AOR34658
UniProt: A0A1D7YGB0
Position
6900490..6901635
Genome map
AA seq 381 aa AA seqDB search
MREFIVEADGGSRGNPGPAGYGAVVRDAATGEPLTEAAEYIGIATNNVAEYRGLLAGLSA
ARALDPTATVHVRMDSKLVIEQMSGRWKIKHPDMKPLATQARSVLPPDQVTYEWIPREQN
KYADRLANEAMDAGTKGEQWSPSRSTAALGEQRPTAPEEQHVSTPGWGSAPDLGAPATFV
LLRHGETPLTPQKRFSGSGGTDPSLSDAGREQARRTAEALARRGTVQAVIASPLTRTRET
AGIVAARLGLDVTIEDGLRETDFGAWEGLTFGEVRDRHPDDLNAWLADPEAHPTGGGESF
AETATRIAATRDKLVAAHAGRTVLLVSHVTPIKTFVRLALGAPPESLFRMELSAASLSAV
AYYADGNASVRLFNDTSHLRP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagttcatcgtcgaggcggacggcggatcacggggcaacccgggccccgcgggc
tacggggcggtcgtccgggacgcggccacgggtgagcccctgacggaggccgcggagtac
atcggcatcgccacgaacaacgtggccgagtaccgcggcctcctggccggcctcagcgcc
gcccgcgccctcgacccgacggccacggtgcacgtccgcatggactccaagctcgtcatc
gagcagatgtcgggccgctggaagatcaaacacccggacatgaagcccctggcgacacag
gcacgatcggtcctgcccccggaccaggtcacctacgagtggatcccgcgagagcagaac
aagtacgcggaccgtttggcgaacgaggcgatggacgcgggcacgaagggcgaacagtgg
tcgccgtcccggtccacggcagctctcggcgagcagcgccccaccgcccccgaggagcag
cacgtctccacaccgggctggggcagcgccccggacctcggggcccctgccaccttcgtg
ctgctccggcacggcgaaacccccctcactccccagaaacgcttctccggcagcggcggc
accgacccctccctctccgacgccggtcgcgaacaggcccgccgcacggccgaggcactc
gcacggcgcggcaccgtccaggccgtcatcgcctcccccctcacccgcacccgcgaaacc
gccggcatcgtcgccgcccgcctggggctggacgtcacgatcgaagacggcctgcgcgaa
acggacttcggcgcctgggaaggcctcaccttcggcgaggtccgcgaccgccaccccgac
gacctgaacgcctggctcgccgaccccgaggcccaccccaccggcggcggcgagagcttc
gccgagacggccacgaggatcgccgccacccgggacaagctggtcgccgcccacgcgggc
cgcacggtcctgctggtcagccatgtgaccccgatcaagacgttcgtccgcctggccctc
ggcgccccgcccgagtccttgttccgcatggaactctcggcggcctccctgtcggcggtg
gcgtactacgcggacggcaacgcgagcgtccggctcttcaacgacacgtcccacctgcgt
ccctga

DBGET integrated database retrieval system